FABP8/M-FABP/Myelin P2 Protein Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit FABP8/M-FABP/Myelin P2 Protein Antibody - BSA Free (NBP3-03262) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human FABP8/M-FABP/Myelin P2 Protein (NP_002668.1). MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PMP2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
| Theoretical MW |
14 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for FABP8/M-FABP/Myelin P2 Protein Antibody - BSA Free
Background
PMP2 (Peripheral myelin protein 2) is a small basic protein found in peripheral nerve myelin and spinal cord myelin, belongs to a family of fatty acid binding proteins. PMP2 partly decreases the inhibitory effect of T suppressors in the culture of immune lymph node cells. Recombinant PMP2 protein was expressed in E.coli and purified by using conventional chromatography techniques.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Publications for FABP8/M-FABP/Myelin P2 Protein Antibody (NBP3-03262) (0)
There are no publications for FABP8/M-FABP/Myelin P2 Protein Antibody (NBP3-03262).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FABP8/M-FABP/Myelin P2 Protein Antibody (NBP3-03262) (0)
There are no reviews for FABP8/M-FABP/Myelin P2 Protein Antibody (NBP3-03262).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FABP8/M-FABP/Myelin P2 Protein Antibody (NBP3-03262) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FABP8/M-FABP/Myelin P2 Protein Products
Research Areas for FABP8/M-FABP/Myelin P2 Protein Antibody (NBP3-03262)
Find related products by research area.
|
Blogs on FABP8/M-FABP/Myelin P2 Protein