FAAP100 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAAP100 Antibody [NBP1-90468] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FAAP100 Antibody [NBP1-90468] - Staining of human kidney shows strong cytoplasmic positivity in proximal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAAP100 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VPLCCATLQWLLAENAAVDVVRARALSSIQGVAPDGANVHLIVREVAMTDLCPAGPIQAVEIQVESSSLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C17ORF70
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAAP100 Protein (NBP1-90468PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAAP100 Antibody

  • C17orf70
  • chromosome 17 open reading frame 70
  • FAAP100
  • Fanconi anemia-associated protein of 100 kDa
  • FLJ22175
  • FLJ30151

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2476
Species: Hu
Applications: WB, IHC
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB100-2564
Species: Hu
Applications: WB
21340002
Species: Hu
Applications: ELISA
NBP1-91876
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84758
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50418
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NBP2-01904
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-92139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4377
Species: Hu, Mu
Applications: WB, ICC
H00002189-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
H00002188-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
NBP1-90468
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FAAP100 Antibody (NBP1-90468) (0)

There are no publications for FAAP100 Antibody (NBP1-90468).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAAP100 Antibody (NBP1-90468) (0)

There are no reviews for FAAP100 Antibody (NBP1-90468). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAAP100 Antibody (NBP1-90468) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAAP100 Products

Bioinformatics Tool for FAAP100 Antibody (NBP1-90468)

Discover related pathways, diseases and genes to FAAP100 Antibody (NBP1-90468). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAAP100

There are no specific blogs for FAAP100, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAAP100 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C17ORF70