FAAH2 Antibody

Images

 
Western Blot: FAAH2 Antibody [NBP1-69705] - This Anti-FAAH2 antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAAH2 Antibody Summary

Immunogen
Synthetic peptides corresponding to FAAH2(fatty acid amide hydrolase 2) The peptide sequence was selected from the C terminal of FAAH2. Peptide sequence SPLWELIKWCLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAAH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FAAH2 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAAH2 Antibody

  • AMDD
  • amidase domain containing
  • Amidase domain-containing protein
  • Anandamide amidohydrolase 2
  • EC 3.5.1.99
  • FAAH-2
  • fatty acid amide hydrolase 2
  • fatty-acid amide hydrolase 2
  • FLJ31204
  • Oleamide hydrolase 2
  • RP11-479E16.1

Background

Fatty acid amide hydrolases, such as FAAH1 and FAAH2, hydrolyze primary fatty acid amide substrates and may play a role in fatty acid catabolism.Fatty acid amide hydrolases, such as FAAH1 (FAAH; MIM 602935) and FAAH2, hydrolyze primary fatty acid amide substrates (e.g., oleamide) and may play a role in fatty acid catabolism (Wei et al., 2006 [PubMed 17015445]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF4886
Species: Mu
Applications: WB, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-606
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NLS164
Species: Hu
Applications: IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
NBP1-83711
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40763
Species: Hu, Mu, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-74960
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
DDX0010P-100
Species: Hu, Ca
Applications: Flow, Func, IHC, IHC-Fr, IP
NBP2-14891
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-30783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAAH2 Antibody (NBP1-69705) (0)

There are no publications for FAAH2 Antibody (NBP1-69705).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAAH2 Antibody (NBP1-69705) (0)

There are no reviews for FAAH2 Antibody (NBP1-69705). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAAH2 Antibody (NBP1-69705) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAAH2 Products

Bioinformatics Tool for FAAH2 Antibody (NBP1-69705)

Discover related pathways, diseases and genes to FAAH2 Antibody (NBP1-69705). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAAH2 Antibody (NBP1-69705)

Discover more about diseases related to FAAH2 Antibody (NBP1-69705).

Blogs on FAAH2

There are no specific blogs for FAAH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAAH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAAH2
Uniprot