F-Spondin/SPON1 Antibody (3F4)

Images

 
There are currently no images for F-Spondin/SPON1 Antibody (H00010418-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

F-Spondin/SPON1 Antibody (3F4) Summary

Immunogen
SPON1 (NP_006099, 699 a.a. ~ 807 a.a) partial recombinant protein with GST tag.PQFGGAPCPETVQRKKCRIRKCLRNPSIQKLRWREARESRRS EQLKEESEGEQFPGCRMRPWTAWSECTKLCGGGIQERYMTVK KRFKSSQFTSCKDKKEIRACNVHP
Localization
Secreted protein; extracellular space; extracellular matrix.
Specificity
SPON1 - spondin 1, extracellular matrix protein
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SPON1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for F-Spondin/SPON1 Antibody (3F4)

  • FSpondin
  • F-Spondin
  • KIAA0762VSGP/F-spondin
  • MGC10724
  • SPON1
  • spondin 1, (f-spondin) extracellular matrix protein
  • spondin 1, extracellular matrix protein
  • spondin-1
  • Vascular smooth muscle cell growth-promoting factor
  • VSGP

Background

SPON1 is a member of a subgroup of the thrombospondin type 1 (TSR) class molecules, defined by two domains of homology, the FS1/FS2 and TSR domains. The TSRs of SPON1 proteins are typical of class 2 TSRs. SPON1, which is similar to thrombospondin, is a extracellular matrix attached molecule that promotes neurite outgrowth and inhibits angiogenesis. Analysis of gain and loss of function experiments reveal that SPON1 is required for accurate pathfinding of embryonic axons, and plays a dual role in patterning axonal trajectories. It promotes the outgrowth of commissural and inhibits the outgrowth of motor axons, and has also been implicated in inflammatory processes in the nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB600-1081
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67511
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-2216
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, PAGE
7270-IL/CF
Species: Hu
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1182
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00010418-M01
Species: Hu
Applications: ELISA

Publications for F-Spondin/SPON1 Antibody (H00010418-M01) (0)

There are no publications for F-Spondin/SPON1 Antibody (H00010418-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for F-Spondin/SPON1 Antibody (H00010418-M01) (0)

There are no reviews for F-Spondin/SPON1 Antibody (H00010418-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for F-Spondin/SPON1 Antibody (H00010418-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for F-Spondin/SPON1 Antibody (H00010418-M01)

Discover related pathways, diseases and genes to F-Spondin/SPON1 Antibody (H00010418-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for F-Spondin/SPON1 Antibody (H00010418-M01)

Discover more about diseases related to F-Spondin/SPON1 Antibody (H00010418-M01).
 

Pathways for F-Spondin/SPON1 Antibody (H00010418-M01)

View related products by pathway.

PTMs for F-Spondin/SPON1 Antibody (H00010418-M01)

Learn more about PTMs related to F-Spondin/SPON1 Antibody (H00010418-M01).
 

Research Areas for F-Spondin/SPON1 Antibody (H00010418-M01)

Find related products by research area.

Blogs on F-Spondin/SPON1

There are no specific blogs for F-Spondin/SPON1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our F-Spondin/SPON1 Antibody (3F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol SPON1
Entrez
OMIM
Uniprot