Recombinant Human EZFIT/ZNF71 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EZFIT/ZNF71 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-489 of Human ZNF71 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKELDPKNDISEDKLSVVGEATGGPTRNGARGPGSEGVWEPGSWPERPRGDAGAEWEPLGIPQGNKLLGGSVPACHELKAFANQGCVLVPPRLDDPTEKGACPPVRRGKNFSSTSDLSKPPMPCEEKKTYDCSECGKAFSRSSSLIKHQRIHTGEKPFECDTCGKHFIERSSLTIHQRVHTGEKPYACGDCGKAFSQRMNLTVHQRTHTGEKPYVCDVCGKAFRKTSSLTQHERIHTGEKPYACGDCGKAFSQNMHLIVHQRTHTGEKPYVCPECGRAFSQNMHLTEHQRTHTGEKPYACKECGKAFNKSSSLTLHQRNHTGEKPYVCGECGKAFSQSSYLIQHQRFHIGVKPFECSECGKAFSKNSSLTQHQRIHTGEKPYECYICKKHFTGRSSLIVHQIVHTGEKPYVCGECGKAFSQSAYLIEHQRIHTGEKPYRCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNTNLTRHLRIHT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ZNF71

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EZFIT/ZNF71 Protein

  • Cos26
  • endothelial zinc finger protein induced by tumor necrosis factor alpha
  • EZFIT
  • Kruppel-related zinc finger protein
  • zinc finger protein 71 (Cos26)
  • zinc finger protein 71EZFITCos26
  • ZNF47
  • ZNF71

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP2-02136
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
AF2409
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready
NBP2-33802
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-86745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P

Publications for EZFIT/ZNF71 Recombinant Protein (H00058491-P01) (0)

There are no publications for EZFIT/ZNF71 Recombinant Protein (H00058491-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EZFIT/ZNF71 Recombinant Protein (H00058491-P01) (0)

There are no reviews for EZFIT/ZNF71 Recombinant Protein (H00058491-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EZFIT/ZNF71 Recombinant Protein (H00058491-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EZFIT/ZNF71 Products

Bioinformatics Tool for EZFIT/ZNF71 Recombinant Protein (H00058491-P01)

Discover related pathways, diseases and genes to EZFIT/ZNF71 Recombinant Protein (H00058491-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EZFIT/ZNF71 Recombinant Protein (H00058491-P01)

Discover more about diseases related to EZFIT/ZNF71 Recombinant Protein (H00058491-P01).

PTMs for EZFIT/ZNF71 Recombinant Protein (H00058491-P01)

Learn more about PTMs related to EZFIT/ZNF71 Recombinant Protein (H00058491-P01).

Blogs on EZFIT/ZNF71

There are no specific blogs for EZFIT/ZNF71, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SR-BI Antibody
NB400-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EZFIT/ZNF71 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF71
Entrez