Exportin 4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Exportin 4 Antibody [NBP2-56750] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Exportin 4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DIHWLILVTGYLLADDTQGETPLIPPEIMEYSIKHSSEVDINTTLQILGSPGEKASSIPGYNRTDSVIRLLSAILRVSEVESRAIRADLTHLLSPQMG
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: XPO4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Exportin 4 Recombinant Protein Antigen (NBP2-56750PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Exportin 4 Antibody - BSA Free

• exp4
• exportin 4
• exportin-4
• KIAA1721FLJ13046

Background

Official Gene Symbol: XPO4 Gen Bank Accession Number: NP_071904 Gene ID: 64328 (human) Gene Map Locus: 13q11 (human) Nuclear transport receptors of karyopherin/importin-beta superfamily mediate various transport pathways between nucleus and cytoplasm. Exportin-4 is a novel mammalian member of this family. It is a RanGTP-binding protein consisting of N-terminal RanGTP-binding motif. It functions as a nuclear export receptor for eIF-5A and also might function as an export adapter in RNA export. It is also involved in nuclear export of Smad3 and regulation of Smad signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: XPO4