Exostosin-like 1/EXTL1 Antibody

Images

 
Immunohistochemistry-Paraffin: Exostosin-like 1/EXTL1 Antibody [NBP1-90470] - Staining of human cerebral cortex shows nuclear positivity in a subset of cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Exostosin-like 1/EXTL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ALPPRPRPGASQGWPRWLDAELLQSFSQPGELPEDAVSPPQAPHGGSCNWESCFDTSKCRGDGLKVFVYPAVGTISETHRRILASIEGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EXTL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Exostosin-like 1/EXTL1 Protein (NBP1-90470PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Exostosin-like 1/EXTL1 Antibody

  • alpha-N-acetylglucosaminyltransferase II
  • EC 2.4.1.224
  • exostoses (multiple)-like 1
  • Exostosin like 1
  • Exostosin-L
  • Exostosin-like 1
  • EXTL1
  • EXTLexostosin-like 1
  • glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
  • Glucuronosyl-N-acetylglucosaminyl-proteoglycan4-alpha-N-acetylglucosaminyltransferase
  • glucuronyl-N-acetylglucosaminylproteoglycan alpha-1,4-N-acetylglucosaminyltransferase
  • MGC70794
  • Multiple exostosis-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91875
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29948
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
AF2536
Species: Mu
Applications: WB
AF2635
Species: Hu
Applications: WB
AF5057
Species: Hu
Applications: WB
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49216
Species: Hu
Applications: ICC/IF, IHC
MAB5579
Species: Hu
Applications: ICC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
1827-SF/CF
Species: Hu
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81397
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
AF5406
Species: Mu
Applications: IHC
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NB100-454
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IP
AF7550
Species: Hu
Applications: WB
NBP1-90470
Species: Hu
Applications: IHC, IHC-P

Publications for Exostosin-like 1/EXTL1 Antibody (NBP1-90470) (0)

There are no publications for Exostosin-like 1/EXTL1 Antibody (NBP1-90470).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Exostosin-like 1/EXTL1 Antibody (NBP1-90470) (0)

There are no reviews for Exostosin-like 1/EXTL1 Antibody (NBP1-90470). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Exostosin-like 1/EXTL1 Antibody (NBP1-90470) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Exostosin-like 1/EXTL1 Products

Bioinformatics Tool for Exostosin-like 1/EXTL1 Antibody (NBP1-90470)

Discover related pathways, diseases and genes to Exostosin-like 1/EXTL1 Antibody (NBP1-90470). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Exostosin-like 1/EXTL1 Antibody (NBP1-90470)

Discover more about diseases related to Exostosin-like 1/EXTL1 Antibody (NBP1-90470).
 

Pathways for Exostosin-like 1/EXTL1 Antibody (NBP1-90470)

View related products by pathway.

Blogs on Exostosin-like 1/EXTL1

There are no specific blogs for Exostosin-like 1/EXTL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Exostosin-like 1/EXTL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EXTL1
Entrez