EXOSC3 Antibody

Images

 
Western Blot: EXOSC3 Antibody [NBP1-91874] - Analysis in control (vector only transfected HEK293T lysate) and EXOSC3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: EXOSC3 Antibody [NBP1-91874] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: EXOSC3 Antibody [NBP1-91874] - Staining of human tonsil shows moderate to strong nuclear positivity in non-germinal and germinal center cells.
Immunohistochemistry-Paraffin: EXOSC3 Antibody [NBP1-91874] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: EXOSC3 Antibody [NBP1-91874] - Analysis in human testis and skeletal muscle tissues. Corresponding EXOSC3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: EXOSC3 Antibody [NBP1-91874] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
Immunohistochemistry-Paraffin: EXOSC3 Antibody [NBP1-91874] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.
Immunohistochemistry: EXOSC3 Antibody [NBP1-91874] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

EXOSC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKD
Specificity
Specificity of human EXOSC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EXOSC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EXOSC3 Protein (NBP1-91874PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EXOSC3 Antibody

  • bA3J10.7
  • CGI-102
  • exosome complex exonuclease RRP40
  • exosome component 3MGC15120
  • exosome component Rrp40
  • hRrp-40
  • hRrp40p
  • p10Rrp40p
  • Ribosomal RNA-processing protein 40
  • RP11-3J10.8
  • RRP40MGC723

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-59707
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-93562
Species: Hu
Applications: WB
NBP1-84545
Species: Hu
Applications: WB, IHC, IHC-P
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NB110-89726
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010263-B01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-62583
Species: Hu
Applications: WB
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for EXOSC3 Antibody (NBP1-91874) (0)

There are no publications for EXOSC3 Antibody (NBP1-91874).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EXOSC3 Antibody (NBP1-91874) (0)

There are no reviews for EXOSC3 Antibody (NBP1-91874). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EXOSC3 Antibody (NBP1-91874) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EXOSC3 Products

Bioinformatics Tool for EXOSC3 Antibody (NBP1-91874)

Discover related pathways, diseases and genes to EXOSC3 Antibody (NBP1-91874). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EXOSC3 Antibody (NBP1-91874)

Discover more about diseases related to EXOSC3 Antibody (NBP1-91874).
 

Pathways for EXOSC3 Antibody (NBP1-91874)

View related products by pathway.

Blogs on EXOSC3

There are no specific blogs for EXOSC3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EXOSC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOSC3