ETV7 Antibody [Janelia Fluor® 525]

Product Discontinued

ETV7 Antibody [Janelia Fluor® 525] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human ETV7 (NP_057219.1).
  
  Sequence:
  MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ETV7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.

Alternate Names for ETV7 Antibody [Janelia Fluor® 525]

• ETS translocation variant 7
• ets variant 7
• ets variant gene 7 (TEL2 oncogene)
• TEL2 oncogene
• TEL-2
• TEL2ETS-related protein Tel2
• TELBEts transcription factor TEL-2b
• Tel-related Ets factor
• transcription factor ets
• transcription factor ETV7
• Transcription factor Tel-2
• TREF

Background

The ETS (E26 transformation-specific) family of transcription factors, of which ETV7 is a member, is a large group of evolutionarily conserved transcriptional regulators that play an important role in a variety of cellular processes throughout development and differentiation, and are involved in oncogenesis as well (Potter et al., 2000 (PubMed 10828014)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ETV7