We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ETV6/Tel Recombinant Protein Antigen

Images

 
There are currently no images for ETV6/Tel Protein (NBP1-80695PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ETV6/Tel Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ETV6.

Source: E. coli

Amino Acid Sequence: NGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ETV6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80695.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ETV6/Tel Recombinant Protein Antigen

  • ETS translocation variant 6
  • ets variant 6
  • ets variant gene 6 (TEL oncogene)
  • ETS-related protein Tel1
  • ETV6
  • TEL
  • TEL/ABL
  • TEL1
  • TELTEL1 oncogene
  • transcription factor ETV6

Background

Tel encodes an ETS family transcription factor. The product of this gene contains two functional domains: a N terminal pointed (PNT) domain that is involved in the protein protein interactions with itself and other proteins, and a C terminal DNA binding domain. Gene knockout studies in mice suggest that it is required for hematopoiesis and maintenance of the developing vascular network. This gene is known to be involved in a large number of chromosomal rearrangements associated with leukemia and congenital fibrosarcoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89105
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-49695
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NBP2-61707
Species: Hu
Applications: ELISA, Flow, WB
NBP1-62489
Species: Dr, Hu, Mu
Applications: WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
203-IL
Species: Hu
Applications: BA
NB100-56546
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF1404
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
NBP1-86602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56585
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1555
Species: Hu
Applications: WB
NBP2-48848
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
AF1042
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
NBP2-55747
Species: Hu
Applications: ICC/IF

Publications for ETV6/Tel Protein (NBP1-80695PEP) (0)

There are no publications for ETV6/Tel Protein (NBP1-80695PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETV6/Tel Protein (NBP1-80695PEP) (0)

There are no reviews for ETV6/Tel Protein (NBP1-80695PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ETV6/Tel Protein (NBP1-80695PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ETV6/Tel Products

Research Areas for ETV6/Tel Protein (NBP1-80695PEP)

Find related products by research area.

Blogs on ETV6/Tel

There are no specific blogs for ETV6/Tel, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ETV6/Tel Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ETV6