Ets-1 Antibody - BSA Free

Western Blot: Ets-1 Antibody [NBP2-56897] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunocytochemistry/Immunofluorescence: Ets-1 Antibody [NBP2-56897] - Staining of human cell line RH-30 shows localization to nucleoplasm. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ets-1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ets-1 Antibody - BSA Free (NBP2-56897) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS
• Predicted Species: Mouse (92%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ETS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Ets-1 Recombinant Protein Antigen (NBP2-56897PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ets-1 Antibody - BSA Free

• Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1
• ets protein
• Ets1
• Ets-1
• EWSR2
• FLJ10768
• p54
• Protein C-Ets-1
• v-ets avian erythroblastosis virus E2 oncogene homolog 1
• v-ets avian erythroblastosis virus E26 oncogene homolog 1
• v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)
• v-ets

Background

Ets-1 is the prototype member of a family of genes identified on the basis of homology to the v-Ets oncogene isolated from the E26 erythroblastosis virus. This family of genes currently includes Ets-1, Ets-2, Erg-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ETS1