ethanolamine kinase Antibody

Images

 
Immunohistochemistry-Paraffin: ethanolamine kinase Antibody [NBP2-33292] - Staining of human kidney shows cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ethanolamine kinase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ETNK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ethanolamine kinase Protein (NBP2-33292PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ethanolamine kinase Antibody

  • EC 2.7.1.82
  • EKI 1
  • EKI
  • EKI1putative protein product of Nbla10396
  • ethanolamine kinase 1
  • Nbla10396

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1585
Species: Hu
Applications: WB, IP
NBP2-53421
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007290-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-84724
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-98506
Species: Mu
Applications: WB
NBP2-20398
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00085465-A01
Species: Hu
Applications: WB, ELISA
NBP2-37371
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
AF432
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF5286
Species: Hu
Applications: WB
AF3629
Species: Hu, Mu, Rt
Applications: WB, Neut
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP1-88825
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85861
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89611
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45677
Species: Hu, Mk
Applications: WB, IHC
NBP2-33292
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for ethanolamine kinase Antibody (NBP2-33292) (0)

There are no publications for ethanolamine kinase Antibody (NBP2-33292).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ethanolamine kinase Antibody (NBP2-33292) (0)

There are no reviews for ethanolamine kinase Antibody (NBP2-33292). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ethanolamine kinase Antibody (NBP2-33292) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ethanolamine kinase Products

Bioinformatics Tool for ethanolamine kinase Antibody (NBP2-33292)

Discover related pathways, diseases and genes to ethanolamine kinase Antibody (NBP2-33292). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ethanolamine kinase Antibody (NBP2-33292)

Discover more about diseases related to ethanolamine kinase Antibody (NBP2-33292).

Blogs on ethanolamine kinase

There are no specific blogs for ethanolamine kinase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ethanolamine kinase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ETNK1
Uniprot