ethanolamine kinase Antibody


Immunohistochemistry-Paraffin: ethanolamine kinase Antibody [NBP2-33292] - Staining of human kidney shows cytoplasmic positivity in cells in tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

ethanolamine kinase Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVR
Specificity of human ethanolamine kinase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ethanolamine kinase Protein (NBP2-33292PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ethanolamine kinase Antibody

  • EC
  • EKI 1
  • EKI
  • EKI1putative protein product of Nbla10396
  • ethanolamine kinase 1
  • Nbla10396


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for ethanolamine kinase Antibody (NBP2-33292) (0)

There are no publications for ethanolamine kinase Antibody (NBP2-33292).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ethanolamine kinase Antibody (NBP2-33292) (0)

There are no reviews for ethanolamine kinase Antibody (NBP2-33292). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ethanolamine kinase Antibody (NBP2-33292) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ethanolamine kinase Products

Bioinformatics Tool for ethanolamine kinase Antibody (NBP2-33292)

Discover related pathways, diseases and genes to ethanolamine kinase Antibody (NBP2-33292). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ethanolamine kinase Antibody (NBP2-33292)

Discover more about diseases related to ethanolamine kinase Antibody (NBP2-33292).

Blogs on ethanolamine kinase

There are no specific blogs for ethanolamine kinase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ethanolamine kinase Antibody and receive a gift card or discount.


Gene Symbol ETNK1