ethanolamine kinase Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit ethanolamine kinase Antibody - BSA Free (NBP2-33292) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: ANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVR |
| Predicted Species |
Mouse (91%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ETNK1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ethanolamine kinase Antibody - BSA Free
Background
ethanolamine kinase encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu
Applications: ICC/IF
Species: Mu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: WB
Species: Mu
Applications: IHC
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for ethanolamine kinase Antibody (NBP2-33292) (0)
There are no publications for ethanolamine kinase Antibody (NBP2-33292).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ethanolamine kinase Antibody (NBP2-33292) (0)
There are no reviews for ethanolamine kinase Antibody (NBP2-33292).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for ethanolamine kinase Antibody (NBP2-33292) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ethanolamine kinase Products
Blogs on ethanolamine kinase