ATAD2B Antibody

Immunocytochemistry/Immunofluorescence: ATAD2B Antibody [NBP1-89611] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: ATAD2B Antibody [NBP1-89611] - Staining of human duodenum shows moderate cytoplasmic and nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ATAD2B Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LEVVSFCDSGDKCSSEQKILLEDQSKEKPETSTENHGDDLEKLEALECSNNEKLEPGSDVEVKDAELDKEGASKVKKYRK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATAD2B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ATAD2B Protein (NBP1-89611PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATAD2B Antibody

• ATAD2B ATPase family, AAA domain containing 2B

Background

ATAD2B belongs to the AAA ATPase family, CDC48 subfamily. This subfamily members in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. The exact function of this protein is not known. [provided by RefSeq, May 2011]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATAD2B