ESX1 Antibody - BSA Free

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ESX1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ESX1 Antibody - BSA Free (NBP3-24824) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein ESX1 using the following amino acid sequence: MESLRGYTHSDIGYRSLAVGEDIEEVNDEKLTVTSLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSDDQDR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ESX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ESX1 Antibody - BSA Free

• ESX homeobox 1
• ESX1LESX1R
• ESX1-related protein
• ESXR1homeobox protein ESX1
• extraembryonic, spermatogenesis, homeobox 1 homolog (mouse)
• extraembryonic, spermatogenesis, homeobox 1 homolog
• Extraembryonic, spermatogenesis, homeobox 1

Background

The ESX1 gene encodes a 406 amino acid long, 44kDA homeobox protein ESX1 that functions in cell cycle progression and transcription during spermatogenesis and plays a critical role in placental development. ESX1 interacts with genes EXOC2 and TRAP1 and is linked to diseases such as testicular germ cell tumors, delayed puberty, hypopituitarism, tuberculosis, and holoprosencephaly.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ESX1