Home » ERV3-1 » ERV3-1 Proteins » ERV3-1 Recombinant Protein Antigen

ERV3-1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ERV3-1 Recombinant Protein Antigen (NBP2-68667PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

ERV3-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERV3-1.

Source: E.coli

Amino Acid Sequence: VCYDPKSSPGIWFEIHVGSKEGDLLNQTKVFPSGKDVVSLYFDVCQIVSMGSLFPVIFSSMEYYSSCHKNRYAHPACSTDSPVTTCWDCTTWSTNQQSLGPIMLTKIPLEPDCKTSTCNSVNLTILEPDQPIWTTGLKAPL
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ERV3-1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-68667. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ERV3-1 Recombinant Protein Antigen

  • Endogenous Retroviral Sequence 3 (Includes Zinc Finger Protein H-Plk/HPF9)
  • Endogenous Retroviral Sequence 3
  • Endogenous Retrovirus Group 3 Member 1 Env Polyprotein
  • Endogenous Retrovirus Group 3 Member 1
  • Endogenous Retrovirus Group 3 Member 1, Envelope
  • Endogenous Retrovirus Group 3, Member 1
  • envelope polyprotein
  • ERV3 Envelope Protein
  • ERV-3 Envelope Protein
  • ERV3
  • ERV3-1 Envelope Protein
  • ERV-R Envelope Protein
  • ERV-R
  • HERVR
  • HERV-R
  • HERV-R_7q21.2 Provirus Ancestral Env Polyprotein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-1 beta/IL-1F2
[Unconjugated]
201-LB/CF
1 μg/lane of Recombinant Human IL-1 beta /IL-1F2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IL-1 beta /IL-1F2 (Catalog # 201-LB/CF) stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED50 for this effect is <12 pg/mL.
(497 Publications)
Species: Hu
Applications: BA
RAPGEF5 Antibody
NBP2-57362
Western Blot: RAPGEF5 Antibody [NBP2-57362] - Analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/Immunofluorescence: RAPGEF5 Antibody [NBP2-57362] - Staining of human cell line PC-3 shows localization to nucleoplasm & nuclear bodies.
Species: Hu
Applications: ICC/IF, WB
HERV Antibody -
BSA Free
NB100-93579
Western Blot: HERV Antibody [NB100-93579] - WB detection of HERV in human placenta lysate with NB100-93579 antibody at a dilution of 1:250
(1 Review)
(2 Publications)
Species: Hu
Applications: B/N, IHC, IHC-Fr, IHC-P, In vitro, WB
IFN-gamma
[Unconjugated]
285-IF
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
(24 Reviews)
(398 Publications)
Species: Hu
Applications: BA
ZNF117 Antibody
NBP1-79243
Western Blot: ZNF117 Antibody [NBP1-79243] - Titration: 0.2-1 ug/ml Positive Control: HT1080 cell lysate.
Western Blot: ZNF117 Antibody [NBP1-79243] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: ZNF117 Antibody [NBP1-79243] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Species: Hu
Applications: WB
PLK1 Antibody
(OTI1D4)
NBP1-48291
Western Blot: PLK1 Antibody (OTI1D4) [NBP1-48291] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PLK1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PLK1.
Immunohistochemistry-Paraffin: PLK1 Antibody (OTI1D4) [NBP1-48291] - Staining of paraffin-embedded Adenocarcinoma of Human colon tissue using anti-PLK1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PLK1 Antibody (OTI1D4) [NBP1-48291] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-PLK1 mouse monoclonal antibody.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
IL-6 [HRP]
D6050
(32 Reviews)
(638 Publications)
Species: Hu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(718 Publications)
Species: Hu
Applications: BA
CMG-2/ANTXR2
Antibody [Unconjugate
AF2940
Human whole blood monocytes were stained with Human CMG‑2/ANTXR2 Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF2940, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107).
(5 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Rpn2 Antibody
NBP2-38323
Immunocytochemistry/Immunofluorescence: Rpn2 Antibody [NBP2-38323] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & actin filaments.
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human cerebral cortex, kidney, liver and testis using Anti-PSMD1 antibody NBP2-38323 (A) shows similar protein distribution across tissues to independent antibody NBP2-38324 (B).
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human testis.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Transglutaminase
1/TGM1 Antibody
NBP2-34062
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human esophagus shows high expression.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human esophagus and colon tissues. Corresponding TGM1 RNA-seq data are presented for the same tissues.
Western Blot: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human tonsil tissue.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Noxa Antibody
(114C307.1) - Non-Rec ...
NB600-1159
Immunocytochemistry/Immunofluorescence: Noxa Antibody (114C307.1) - Non-Recombinant Monoclonal [NB600-1159] - ICC/IF analysis using the azide-free version of NB600-1159 at 1:10. HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red). Image objective 40X.
Immunohistochemistry-Paraffin: Noxa Antibody (114C307.1) - Non-Recombinant Monoclonal [NB600-1159] - Bouin-fixed, paraffin-embedded Chronic Lymphocytic Leukemia (CLL) xenograft stained with Noxa antibody (1:2000), peroxidase-conjugate and DAB chromogen. Staining for 2 hr at RT. Image using the azide-free form of this antibody.
Flow Cytometry: Noxa Antibody (114C307.1) - Non-Recombinant Monoclonal [NB600-1159] - Flow cytometry after an intracellular stain was performed on HeLa cells with Noxa [114C307.1] antibody NB600-1159AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
(2 Reviews)
(73 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
GAPDH Antibody
(1D4)
NB300-221
Western Blot: GAPDH Antibody (1D4) [NB300-221] - Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.
Immunocytochemistry/Immunofluorescence: GAPDH Antibody (1D4) [NB300-221] - Analysis of of HeLa cells stained with GAPDH antibody, dilution 1:100 (Green). DAPI staining of nuclear DNA (Blue). The GAPDHantibody produces strong cytoplasmic staining of healthy cells.
Immunocytochemistry/Immunofluorescence: GAPDH Antibody (1D4) [NB300-221] - SH-SY5Y cells stained with GAPDH antibody NB300-221 (green). Nuclear DNA is stained with Hoechst dye (blue).
(19 Reviews)
(358 Publications)
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
POMT1 Antibody
NBP3-12487
Immunohistochemistry-Paraffin: POMT1 Antibody [NBP3-12487] - 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 40x magnification.
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
LRP-1 Antibody
(A2Mr alpha-2) - BSA ...
NB100-64808
Immunohistochemistry: LRP-1 Antibody (A2Mr alpha-2) [NB100-64808] - Immunoperoxidase staining of a human tonsil cryosection with Mouse anti Human CD91 antibody, clone A2Mr alpha-2 followed by the Histar detection system. Low power.
Immunohistochemistry: LRP-1 Antibody (A2Mr alpha-2) [NB100-64808] - Immunoperoxidase staining of a human tonsil cryosection with Mouse anti Human CD91 antibody, clone A2Mr alpha-2 followed by the Histar detection system. Medium power.
Immunohistochemistry: LRP-1 Antibody (A2Mr alpha-2) [NB100-64808] - Immunoperoxidase staining of a human tonsil cryosection with Mouse anti Human CD91 antibody, clone A2Mr alpha-2 followed by the Histar detection system. Medium power.
(2 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, IF, IHC, IHC-Fr, IP, WB
ERV3-1 Recombinant
Protein Antigen
NBP2-68667PEP
ERV3-1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ERV3-1 Recombinant Protein Antigen (NBP2-68667PEP) (0)

There are no publications for ERV3-1 Recombinant Protein Antigen (NBP2-68667PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERV3-1 Recombinant Protein Antigen (NBP2-68667PEP) (0)

There are no reviews for ERV3-1 Recombinant Protein Antigen (NBP2-68667PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ERV3-1 Recombinant Protein Antigen (NBP2-68667PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERV3-1 Products

Array NBP2-68667PEP

Bioinformatics Tool for ERV3-1 Recombinant Protein Antigen (NBP2-68667PEP)

Discover related pathways, diseases and genes to ERV3-1 Recombinant Protein Antigen (NBP2-68667PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ERV3-1

There are no specific blogs for ERV3-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
IL-6 [HRP]
IL-6 [HRP]
D6050

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ERV3-1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ERV3-1