ERRFI1 Antibody - BSA Free

Western Blot: ERRFI1 Antibody [NBP1-81835] - Analysis in human cell line U-87 MG.

Immunocytochemistry/Immunofluorescence: ERRFI1 Antibody [NBP1-81835] - Staining of human cell line U-2 OS shows positivity in cytoplasm. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ERRFI1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NGGVPDPNPPPPQTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDKPEVPPRVPIPPRPVKPDYRRWSAEVTSSTY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERRFI1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ERRFI1 Protein (NBP1-81835PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ERRFI1 Antibody - BSA Free

• ERBB receptor feedback inhibitor 1
• GENE-33
• MIG6
• MIG-6Mitogen-inducible gene 6 protein
• RALTreceptor-associated late transducer

Background

ERRFI1 - mitogen-inducible gene 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ERRFI1