ERMN Antibody - BSA Free

Immunohistochemistry-Paraffin: ERMN Antibody [NBP1-84802] - Analysis in human cerebral cortex and liver tissues using NBP1-84802 antibody. Corresponding ERMN RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ERMN Antibody [NBP1-84802] - Staining of human cerebellum, cerebral cortex, liver and prostate using Anti-ERMN antibody NBP1-84802 (A) shows similar protein distribution across tissues to independent antibody NBP1-84801 (B).

Western Blot: ERMN Antibody [NBP1-84802] - Analysis in control (vector only transfected HEK293T lysate) and ERMN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: ERMN Antibody [NBP1-84802] - Staining of human prostate shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: ERMN Antibody [NBP1-84802] - Staining of human cerebral cortex shows strong cytoplasmic positivity in oligodendrocytes.

Immunohistochemistry-Paraffin: ERMN Antibody [NBP1-84802] - Staining of human cerebellum shows strong positivity in oligodendrocytes.

Immunohistochemistry-Paraffin: ERMN Antibody [NBP1-84802] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ERMN Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSRYNTISYRK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERMN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ERMN Protein (NBP1-84802PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ERMN Antibody - BSA Free

• ERMIN
• ermin, ERM-like protein
• JNKIAA1189ermin
• juxtanodin

Background

ERMN plays a role in cytoskeletal rearrangements during the late wrapping and/or compaction phases ofmyelinogenesis as well as in maintenance and stability of myelin sheath in the adult. May play an important role inlate-stage oligodendroglia maturation, myeli

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ERMN Antibody (NBP1-84802)(2)

Publications using NBP1-84802

• Hernandez-Clavijo A, Sánchez Triviño C, Guarneri G et al. Shedding light on human olfaction: electrophysiological recordings from sensory neurons in acute slices of olfactory epithelium bioRxiv 2023-03-27
• Hernandez-Clavijo A, S�nchez Trivi�o CA, Guarneri G et al. Shedding light on human olfaction: Electrophysiological recordings from sensory neurons in acute slices of olfactory epithelium iScience 2023-07-21 [PMID: 37456832] (Block/Neutralize)

Bioinformatics

• Gene Symbol: ERMN