ERMAP Recombinant Protein Antigen

Images

 
There are currently no images for ERMAP Recombinant Protein Antigen (NBP3-21285PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ERMAP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERMAP

Source: E.coli

Amino Acid Sequence: IWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ERMAP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21285. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ERMAP Recombinant Protein Antigen

  • ERMAP
  • erythroblast membrane-associated protein (RD and SC blood groups)
  • erythroblast membrane-associated protein (Scianna blood group)
  • erythroblast membrane-associated protein
  • erythroid membrane-associated protein
  • hERMAP
  • MGC118810
  • MGC118811
  • PRO2801
  • Radin blood group (Rd)
  • Radin blood group antigen
  • Radin blood group
  • RD
  • RDMGC118812
  • SC
  • Scianna blood group (Sc)
  • Scianna blood group antigen
  • Scianna blood group
  • SCMGC118813

Background

ERMAP is encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
291-G1
Species: Hu
Applications: BA
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
M6000B
Species: Mu
Applications: ELISA
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56605
Species: Av, Bv, Sh
Applications: WB
202-IL
Species: Hu
Applications: BA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for ERMAP Recombinant Protein Antigen (NBP3-21285PEP) (0)

There are no publications for ERMAP Recombinant Protein Antigen (NBP3-21285PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERMAP Recombinant Protein Antigen (NBP3-21285PEP) (0)

There are no reviews for ERMAP Recombinant Protein Antigen (NBP3-21285PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ERMAP Recombinant Protein Antigen (NBP3-21285PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERMAP Products

Diseases for ERMAP Recombinant Protein Antigen (NBP3-21285PEP)

Discover more about diseases related to ERMAP Recombinant Protein Antigen (NBP3-21285PEP).
 

Pathways for ERMAP Recombinant Protein Antigen (NBP3-21285PEP)

View related products by pathway.

PTMs for ERMAP Recombinant Protein Antigen (NBP3-21285PEP)

Learn more about PTMs related to ERMAP Recombinant Protein Antigen (NBP3-21285PEP).

Blogs on ERMAP

There are no specific blogs for ERMAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ERMAP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ERMAP