ERH Antibody - Azide and BSA Free

Images

 
Western Blot: ERH Antibody [NBP3-04401] - Analysis of extracts of various cell lines, using ERH antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

ERH Antibody - Azide and BSA Free Summary

Description
Novus Biologicals Rabbit ERH Antibody - Azide and BSA Free (NBP3-04401) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-104 of human ERH (NP_004441.1). MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERH
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500-1:2000
Theoretical MW
12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for ERH Antibody - Azide and BSA Free

  • DROER
  • enhancer of rudimentary (Drosophila) homolog
  • enhancer of rudimentary homolog (Drosophila)
  • enhancer of rudimentary homolog
  • FLJ27340

Background

ERH (Enhancer of rudimentary homolog) is ubiquitously expressed in tissues and may play a role in the cell cycle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84297
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-92392
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00004205-M15
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-74624
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-89979
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P
NBP2-24509
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-84463
Species: Hu
Applications: IHC,  IHC-P, IP
NBP1-84466
Species: Hu
Applications: IHC,  IHC-P, WB
MAB7957
Species: Hu
Applications: ICC, IHC, KO, Simple Western, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-68858
Species: Hu
Applications: IHC,  IHC-P
NB100-757
Species: Hu
Applications: ChIP, IHC,  IHC-P, WB
NLS1150
Species: Hu
Applications: IHC,  IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Simple Western, WB
NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for ERH Antibody (NBP3-04401) (0)

There are no publications for ERH Antibody (NBP3-04401).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERH Antibody (NBP3-04401) (0)

There are no reviews for ERH Antibody (NBP3-04401). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERH Antibody (NBP3-04401) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERH Products

Research Areas for ERH Antibody (NBP3-04401)

Find related products by research area.

Blogs on ERH

There are no specific blogs for ERH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERH Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ERH