ERH Antibody

Images

 
Western Blot: ERH Antibody [NBP1-84976] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: ERH Antibody [NBP1-84976] - Staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: ERH Antibody [NBP1-84976] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Western Blot: ERH Antibody [NBP1-84976] - Analysis in human cell line A-431.
Immunohistochemistry-Paraffin: ERH Antibody [NBP1-84976] - Staining of human stomach shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ERH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ERH Protein (NBP1-84976PEP)
Publications
Read Publication using NBP1-84976.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ERH Antibody

  • DROER
  • enhancer of rudimentary (Drosophila) homolog
  • enhancer of rudimentary homolog (Drosophila)
  • enhancer of rudimentary homolog
  • FLJ27340

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92392
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74624
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-84463
Species: Hu
Applications: IHC, IHC-P
NBP1-84466
Species: Hu
Applications: WB, IHC, IHC-P
MAB7957
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00056996-R01
Species: Hu
NB100-757
Species: Hu
Applications: WB, IHC-P
NLS1150
Species: Hu
Applications: IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for ERH Antibody (NBP1-84976)(1)

Reviews for ERH Antibody (NBP1-84976) (0)

There are no reviews for ERH Antibody (NBP1-84976). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ERH Antibody (NBP1-84976) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERH Products

Bioinformatics Tool for ERH Antibody (NBP1-84976)

Discover related pathways, diseases and genes to ERH Antibody (NBP1-84976). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERH Antibody (NBP1-84976)

Discover more about diseases related to ERH Antibody (NBP1-84976).
 

Pathways for ERH Antibody (NBP1-84976)

View related products by pathway.

PTMs for ERH Antibody (NBP1-84976)

Learn more about PTMs related to ERH Antibody (NBP1-84976).
 

Research Areas for ERH Antibody (NBP1-84976)

Find related products by research area.

Blogs on ERH

There are no specific blogs for ERH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERH