ERH Antibody - BSA Free

Western Blot: ERH Antibody [NBP1-84976] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: ERH Antibody [NBP1-84976] - Staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.

Western Blot: ERH Antibody [NBP1-84976] - Analysis in human cell line A-431.

Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.

Staining of human small intestine shows strong nuclear positivity in glandular cells.

Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Staining of human cervix shows strong nuclear positivity in squamous epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ERH Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ERH Antibody - BSA Free (NBP1-84976) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-ERH Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ERH Protein (NBP1-84976PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ERH Antibody - BSA Free

• DROER
• enhancer of rudimentary (Drosophila) homolog
• enhancer of rudimentary homolog (Drosophila)
• enhancer of rudimentary homolog
• FLJ27340

Background

ERH (Enhancer of rudimentary homolog) is ubiquitously expressed in tissues and may play a role in the cell cycle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ERH Antibody (NBP1-84976)(2)

Publications using NBP1-84976

• Tsai YM, Wu KL, Huang YC et al. Upregulated enhancer of rudimentary homolog promotes epithelial?mesenchymal transition and cancer cell migration in lung adenocarcinoma Molecular medicine reports 2024-01-01 [PMID: 37997813] (KD, IHC-P, WB, Human)
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: ERH