ERCC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ERCC1 Antibody [NBP2-55616] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ERCC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMC
Specificity
Specificity of human ERCC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERCC1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ERCC1 Recombinant Protein Antigen (NBP2-55616PEP)

Reactivity Notes

Mouse 87%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ERCC1 Antibody

  • COFS4
  • DNA excision repair protein ERCC-1
  • ERCC1
  • excision repair cross-complementing rodent repair deficiency, complementationgroup 1 (includes overlapping antisense sequence)
  • RAD10
  • UV20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-74883
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
AF3296
Species: Hu, Mu, Rt
Applications: WB
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-74611
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NB100-93321
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87154
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005810-M01J
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi, S-ELISA, ELISA(Cap)
NB100-61060
Species: Hu, Mu, V-Vi
Applications: WB, ChIP, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP3-05061
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-404
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP2-76914
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55616
Species: Hu
Applications: ICC/IF

Publications for ERCC1 Antibody (NBP2-55616) (0)

There are no publications for ERCC1 Antibody (NBP2-55616).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERCC1 Antibody (NBP2-55616) (0)

There are no reviews for ERCC1 Antibody (NBP2-55616). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ERCC1 Antibody (NBP2-55616) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ERCC1 Products

Bioinformatics Tool for ERCC1 Antibody (NBP2-55616)

Discover related pathways, diseases and genes to ERCC1 Antibody (NBP2-55616). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERCC1 Antibody (NBP2-55616)

Discover more about diseases related to ERCC1 Antibody (NBP2-55616).
 

Pathways for ERCC1 Antibody (NBP2-55616)

View related products by pathway.

PTMs for ERCC1 Antibody (NBP2-55616)

Learn more about PTMs related to ERCC1 Antibody (NBP2-55616).
 

Research Areas for ERCC1 Antibody (NBP2-55616)

Find related products by research area.

Blogs on ERCC1.

Beta Tubulin III and neurogenesis
Beta tubulin III, also known as Tuj-1, is a class III member of the beta tubulin protein family. Beta tubulins are one of two structural components that form our microtubule network. While general tubulins play a role in a wide range of cellular pr...  Read full blog post.

53BP1 - a marker for DNA Double Strand Break
53BP1 (p53 binding protein 1) was originally thought to be an enhancer for p53 transcriptional, but later studies have demonstrated that it is actually a substrate for ataxia telangiectasia mutated (ATM). 53BP1 is a classic late DNA damage response...  Read full blog post.

53BP1 - DNA damage is no fun
The 53BP1 (p53 binding protein 1) was initially believed to be a p53 transcriptional enhancing partner, but it has now been established as an ataxia telangiectasia mutated (ATM) substrate. As a late DNA damage response (DDR) marker, 53BP1 appears duri...  Read full blog post.

Using PCNA as an Antibody Marker
PCNA antibodies are useful biomarkers in DNA repair studies. PCNA is one of several proteins essential for the completion of nucleotide excision repair, a multi-stage process involving 20 - 30 proteins, and an important factor in repairing damage and...  Read full blog post.

NER Antibodies in Cancer Research
We at Novus Biologicals have over 230 products in our antibody catalog devoted to nucleotide excision repair. NER is a multi-stage sequential process involving over 30 proteins, all of which have been widely studied. Being the primary method to repair...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERCC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERCC1