ErbB4/Her4 Recombinant Protein Antigen

Images

 
There are currently no images for ErbB4/Her4 Recombinant Protein Antigen (NBP1-90371PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ErbB4/Her4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERBB4.

Source: E. coli

Amino Acid Sequence: LPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ERBB4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90371.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ErbB4/Her4 Recombinant Protein Antigen

  • avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4
  • EC 2.7.10
  • EC 2.7.10.1
  • ErbB4
  • HER4
  • HER4MGC138404
  • p180erbB4
  • Proto-oncogene-like protein c-ErbB-4
  • receptor tyrosine-protein kinase erbB-4
  • Tyrosine kinase-type cell surface receptor HER4
  • v-erb-a avian erythroblastic leukemia viral oncogene homolog-like 4
  • v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian)

Background

erbB4/HER4 is a receptor tyrosine kinase that belongs to the human epidermal growth factor receptor (EGFR) family. erbB4/HER4 is most predominantly expressed in several breast carcinoma cell lines, and in normal skeletal muscle, heart, pituitary, brain, and cerebellum (1). erbB4/HER4 is activated by neuregulins (NRG), betacellulin (BTC), and heparin-binding EGF-like growth factor (2). Neuregulins regulate the expression of ligand- and voltage-gated channels in neurons and skeletal muscle by the activation of ErbB 1-4. The erbB4/HER4 receptor is unique among these receptors because its C-terminal tail binds to a protein motif known as the PDZ domain (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
1129-ER
Species: Hu
Applications: BA
MAB3481
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, Neut
236-EG
Species: Hu
Applications: BA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
261-CE
Species: Hu
Applications: BA
AF-259-NA
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB6860
Species: Hu
Applications: IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF-259-NA
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
AF1905
Species: Mu
Applications: WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NBP1-90371PEP
Species: Hu
Applications: AC

Publications for ErbB4/Her4 Recombinant Protein Antigen (NBP1-90371PEP) (0)

There are no publications for ErbB4/Her4 Recombinant Protein Antigen (NBP1-90371PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ErbB4/Her4 Recombinant Protein Antigen (NBP1-90371PEP) (0)

There are no reviews for ErbB4/Her4 Recombinant Protein Antigen (NBP1-90371PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ErbB4/Her4 Recombinant Protein Antigen (NBP1-90371PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ErbB4/Her4 Products

Research Areas for ErbB4/Her4 Recombinant Protein Antigen (NBP1-90371PEP)

Find related products by research area.

Blogs on ErbB4/Her4.

Hypoxia-Dependent CAR Stabilizing Construct in T cells Improves Solid Tumor Targeting and Efficacy
By Victoria Osinski, PhDDespite advances in the development of cancer immunotherapies, those specifically targeting tumors still remains limited. Currently, there is great interest in utilizing chimeric antigen rece...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ErbB4/Her4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ERBB4