ErbB2/Her2 Recombinant Protein Antigen

Images

 
There are currently no images for ErbB2/Her2 Recombinant Protein Antigen (NBP2-52896PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ErbB2/Her2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERBB2.

Source: E. coli

Amino Acid Sequence: YNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFGAPHR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ERBB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52896. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ErbB2/Her2 Recombinant Protein Antigen

  • CD340 antigen
  • CD340
  • c-erb B2/neu protein
  • EC 2.7.10
  • EGFR2
  • ErbB2
  • HER2
  • HER-2
  • HER2EC 2.7.10.1
  • herstatin
  • Metastatic lymph node gene 19 protein
  • MLN 19
  • MLN19
  • Neu Oncogene
  • NEUHER-2/neu
  • neuroblastoma/glioblastoma derived oncogene homolog
  • NGL
  • NGLTKR1
  • p185erbB2
  • Proto-oncogene c-ErbB-2
  • Proto-oncogene Neu
  • receptor tyrosine-protein kinase erbB-2
  • TKR1
  • Tyrosine kinase-type cell surface receptor HER2
  • v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2(neuro/glioblastoma derived oncogene homolog)
  • v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastomaderived oncogene homolog (avian)

Background

ErbB2/HER2 is one of the four members of the ErbB receptor family of transmembrane receptor-like tyrosine kinases (1). The kinase activity of ErbB2 can be activated without ligand if it is overexpressed, and by association with other ErbB proteins (2). Overexpression of ErbB2 is detected in almost 40% of human breast cancers (3). Binding of c-Cbl ubiquitin ligase to Tyr1112 of ErbB2 leads to poly-ubiquitination of ErbB2 and enhances its degradation (4). ErbB2 is one of the major targets for the treatment of breast cancer and other carcinomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
236-EG
Species: Hu
Applications: BA
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB3481
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, Neut
MAB1131
Species: Hu
Applications: ICC, IHC, WB
DVE00
Species: Hu
Applications: ELISA
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-26612
Species: Hu
Applications: IP (-), WB

Publications for ErbB2/Her2 Recombinant Protein Antigen (NBP2-52896PEP) (0)

There are no publications for ErbB2/Her2 Recombinant Protein Antigen (NBP2-52896PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ErbB2/Her2 Recombinant Protein Antigen (NBP2-52896PEP) (0)

There are no reviews for ErbB2/Her2 Recombinant Protein Antigen (NBP2-52896PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ErbB2/Her2 Recombinant Protein Antigen (NBP2-52896PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in getting antibodies for HER that would work in flow cytometry. Could you recommend some choices?
    • A list of our ErbB2 antibodies validated for use in flow cytometry can be found here /productsearch/HER2#fq=common_name%3A%22ErbB2%2FHER2%22&fq=category%3A%22Primary%20Antibodies%22&fq=applications%3A%22Flow%20Cytometry%22

Additional ErbB2/Her2 Products

Research Areas for ErbB2/Her2 Recombinant Protein Antigen (NBP2-52896PEP)

Find related products by research area.

Blogs on ErbB2/Her2.

Unlocking the Potential of Biosimilars in Immuno-Oncology
By Jennifer Jones, M.S.Biosimilar Antibodies: Imitation Meets InnovationIn the ever-evolving medical landscape, a new class of pharmaceuticals is emerging as a game-changer, poised to transform the way we approach...  Read full blog post.

NPC1: A Potential Target For Triple-Negative Breast Cancer
By Natalia Gurule, PhD Breast Cancer is a Heterogeneous DiseaseBreast cancer is the most frequently identified malignancy in women, accounting for 30% of diagnosed cases of cancer in women in the US annuall...  Read full blog post.

Hypoxia-Dependent CAR Stabilizing Construct in T cells Improves Solid Tumor Targeting and Efficacy
By Victoria Osinski, PhDDespite advances in the development of cancer immunotherapies, those specifically targeting tumors still remains limited. Currently, there is great interest in utilizing chimeric antigen rece...  Read full blog post.

Harnessing Natural Killer Cell Activity for Anti-Tumor Immunotherapy
By Victoria Osinski, PhDWhat’s “Natural” About Natural Killer (NK) Cells?For immunologists, the term cytotoxicity often conjures up images of an army of antigen specific CD8+ T cells deploying to ...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ErbB2/Her2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ERBB2