| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ErbB2/Her2. Source: E. coli Amino Acid Sequence: YNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFGAPHR Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | ERBB2 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34472. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW | 32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for ErbB2/Her2 Recombinant Protein Antigen (NBP2-34472PEP)Find related products by research area.
|
|
Unlocking the Potential of Biosimilars in Immuno-Oncology By Jennifer Jones, M.S.Biosimilar Antibodies: Imitation Meets InnovationIn the ever-evolving medical landscape, a new class of pharmaceuticals is emerging as a game-changer, poised to transform the way we approach... Read full blog post. |
|
NPC1: A Potential Target For Triple-Negative Breast Cancer By Natalia Gurule, PhD Breast Cancer is a Heterogeneous DiseaseBreast cancer is the most frequently identified malignancy in women, accounting for 30% of diagnosed cases of cancer in women in the US annuall... Read full blog post. |
|
Hypoxia-Dependent CAR Stabilizing Construct in T cells Improves Solid Tumor Targeting and Efficacy By Victoria Osinski, PhDDespite advances in the development of cancer immunotherapies, those specifically targeting tumors still remains limited. Currently, there is great interest in utilizing chimeric antigen rece... Read full blog post. |
|
Harnessing Natural Killer Cell Activity for Anti-Tumor Immunotherapy By Victoria Osinski, PhDWhat’s “Natural” About Natural Killer (NK) Cells?For immunologists, the term cytotoxicity often conjures up images of an army of antigen specific CD8+ T cells deploying to ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ERBB2 |