Recombinant Human ErbB2/Her2 Protein

Product Discontinued

Recombinant Human ErbB2/Her2 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 22-121 of Human ErbB2/Her2
  
  

  Source: Wheat Germ

  Amino Acid Sequence: STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD

• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: ERBB2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 36.74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ErbB2/Her2 Protein

• CD340 antigen
• CD340
• c-erb B2/neu protein
• EC 2.7.10
• EGFR2
• ErbB2
• HER2
• HER-2
• HER2EC 2.7.10.1
• herstatin
• Metastatic lymph node gene 19 protein
• MLN 19
• MLN19
• Neu Oncogene
• NEUHER-2/neu
• neuroblastoma/glioblastoma derived oncogene homolog
• NGL
• NGLTKR1
• p185erbB2
• Proto-oncogene c-ErbB-2
• Proto-oncogene Neu
• receptor tyrosine-protein kinase erbB-2
• TKR1
• Tyrosine kinase-type cell surface receptor HER2
• v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2(neuro/glioblastoma derived oncogene homolog)
• v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastomaderived oncogene homolog (avian)

Background

ERBB2 - v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for ErbB2/Her2 Partial Recombinant Protein (H00002064-Q01)(2)

Publications using H00002064-Q01

• Knutson KL, Clynes R, Shreeder B, Yeramian P. Improved survival of HER2+ breast cancer patients treated with trastuzumab and chemotherapy is associated with host antibody immunity against the HER2 intracellular domain. Cancer Research. 2016-04-20 [PMID: 27197192] (ELISA)
• Karyampudi L, Formicola C, Erskine CL et al. A degenerate HLA-DR epitope pool of HER-2/neu reveals a novel in vivo immunodominant epitope, HER-2/neu88-102. Clin Cancer Res 16(3):825-34. 2010-02-01 [PMID: 20103660]

FAQs for ErbB2/Her2 Partial Recombinant Protein (H00002064-Q01). (Showing 1 - 1 of 1 FAQs).

1. I am interested in getting antibodies for HER that would work in flow cytometry. Could you recommend some choices?
   • A list of our ErbB2 antibodies validated for use in flow cytometry can be found here /productsearch/HER2#fq=common_name%3A%22ErbB2%2FHER2%22&fq=category%3A%22Primary%20Antibodies%22&fq=applications%3A%22Flow%20Cytometry%22

Bioinformatics

• Gene Symbol: ERBB2