EPS8L1 Antibody


Western Blot: EPS8L1 Antibody [NBP1-56615] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Western Blot: EPS8L1 Antibody [NBP1-56615] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: EPS8L1 Antibody [NBP1-56615] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: EPS8L1 Antibody [NBP1-56615] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.
Western Blot: EPS8L1 Antibody [NBP1-56615] - Jurkat, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that EPS8L1 is expressed in Jurkat.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

EPS8L1 Antibody Summary

Synthetic peptides corresponding to EPS8L1(EPS8-like 1) The peptide sequence was selected from the middle region of EPS8L1. Peptide sequence LQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEAVMEKQKKKVEG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against EPS8L1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EPS8L1 Antibody

  • DRC3EPS8R1
  • epidermal growth factor receptor kinase substrate 8-like protein 1
  • Epidermal growth factor receptor pathway substrate 8-related protein 1
  • EPS8-like 1
  • EPS8-like protein 1
  • EPS8-related protein 1
  • FLJ20258
  • MGC23164
  • MGC4642


EPS8L1 a protein that is related to epidermal growth factor receptor pathway substrate 8 (EPS8), a substrate for the epidermal growth factor receptor. The function of this protein is unknown. This gene encodes a protein that is related to epidermal growth factor receptor pathway substrate 8 (EPS8), a substrate for the epidermal growth factor receptor. The function of this protein is unknown. At least two alternatively spliced transcript variants encoding different isoforms have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB

Publications for EPS8L1 Antibody (NBP1-56615) (0)

There are no publications for EPS8L1 Antibody (NBP1-56615).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPS8L1 Antibody (NBP1-56615) (0)

There are no reviews for EPS8L1 Antibody (NBP1-56615). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EPS8L1 Antibody (NBP1-56615) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for EPS8L1 Antibody (NBP1-56615)

Discover related pathways, diseases and genes to EPS8L1 Antibody (NBP1-56615). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for EPS8L1 Antibody (NBP1-56615)

View related products by pathway.

PTMs for EPS8L1 Antibody (NBP1-56615)

Learn more about PTMs related to EPS8L1 Antibody (NBP1-56615).

Blogs on EPS8L1

There are no specific blogs for EPS8L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EPS8L1 Antibody and receive a gift card or discount.


Gene Symbol EPS8L1