EPS8L2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: EPS8L2 Antibody [NBP1-83613] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

Immunohistochemistry-Paraffin: EPS8L2 Antibody [NBP1-83613] - Staining in human small intestine and skeletal muscle tissues.. Corresponding EPS8L2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: EPS8L2 Antibody [NBP1-83613] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.

Immunohistochemistry-Paraffin: EPS8L2 Antibody [NBP1-83613] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: EPS8L2 Antibody [NBP1-83613] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Staining of human skeletal muscle shows no positivity in myocytes.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells))Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells))

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EPS8L2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESWMRPRSEWPREPQVPLYVPKFHSGWEPPVDVLQEAPWEVEGLASAPIEEVSPVSR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPS8L2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EPS8L2 Protein (NBP1-83613PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EPS8L2 Antibody - BSA Free

• epidermal growth factor receptor kinase substrate 8-like protein 2
• Epidermal growth factor receptor pathway substrate 8-related protein 2
• EPS8-like 2
• EPS8-like protein 2
• EPS8R2
• EPS8-related protein 2
• FLJ16738
• FLJ21935
• FLJ22171
• MGC126530
• MGC3088

Background

EPS8L2 encodes a member of the EPS8 gene family. The encoded protein, like other members of the family, is thought to link growth factor stimulation to actin organization, generating functional redundancy in the pathways that regulate actin cytoskeletal remodeling. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EPS8L2 Antibody (NBP1-83613)(1)

Publication using NBP1-83613

• Dunn JS Unbiased global proteomic profiling of patient-derived meningiomas of all grades to identify molecular signatures of differentially expressed proteins and phosphoproteins. Thesis (IHC-P, Human)

Bioinformatics

• Gene Symbol: EPS8L2