EPS15 Recombinant Protein Antigen

Images

 
There are currently no images for EPS15 Recombinant Protein Antigen (NBP2-68773PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EPS15 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EPS15.

Source: E. coli

Amino Acid Sequence: DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EPS15
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68773.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EPS15 Recombinant Protein Antigen

  • AF1P
  • AF-1P
  • ALL1 fused gene from chromosome 1
  • epidermal growth factor receptor pathway substrate 15
  • epidermal growth factor receptor substrate 15
  • Eps15
  • MLLT5
  • Protein AF-1p
  • Protein Eps15

Background

EPS15 is a ubiquitously expressed protein that is involved in cell growth regulation and may be involved in the regulation of mitogenic signals and control of cell proliferation. EPS15 may be phosphorylated on tyrosine 849 following DNA damage, resulting in the internalization of EGFR. A chromosomal aberration involving EPS15 is also found in acute myelogeneous leukemias, resulting in a rogue activator protein, so EPS15 antibodies may be useful for cancer research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
2914-HT
Species: Hu
Applications: BA
236-EG
Species: Hu
Applications: BA
NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-22015
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IP, WB
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-83202
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00030845-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-88149
Species: Hu
Applications: IP, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-04017
Species: Hu
Applications: IP, WB
NBP2-47477
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80891
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-25690
Species: Fe, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB

Publications for EPS15 Recombinant Protein Antigen (NBP2-68773PEP) (0)

There are no publications for EPS15 Recombinant Protein Antigen (NBP2-68773PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPS15 Recombinant Protein Antigen (NBP2-68773PEP) (0)

There are no reviews for EPS15 Recombinant Protein Antigen (NBP2-68773PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EPS15 Recombinant Protein Antigen (NBP2-68773PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EPS15 Products

Research Areas for EPS15 Recombinant Protein Antigen (NBP2-68773PEP)

Find related products by research area.

Blogs on EPS15

There are no specific blogs for EPS15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EPS15 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EPS15