EPRS Antibody - BSA Free

Western Blot: EPRS Antibody [NBP3-35516] - Western blot analysis of various lysates using EPRS Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EPRS Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EPRS Antibody - BSA Free (NBP3-35516) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human EPRS (NP_004437.2).
  
  Sequence:
  EAKVLFDKVASQGEVVRKLKTEKAPKDQVDIAVQELLQLKAQYKSLIGVEYKPVSATGAEDKDKKKKEKENKSEKQNKPQKQNDGQRKDPSKNQGGGLSSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPRS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 171 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for EPRS Antibody - BSA Free

• bifunctional aminoacyl-tRNA synthetase
• Cell proliferation-inducing gene 32 protein
• DKFZp313B047
• EARS
• EC 6.1.1
• EC 6.1.1.15
• EC 6.1.1.18
• GLNS
• GLUPRORS
• glutamate tRNA ligase
• glutaminyl-tRNA synthetase
• glutamyl-prolyl-tRNA synthetase
• PARSproliferation-inducing gene 32 protein
• proliferation-inducing protein 32
• proline tRNA ligase
• proline-tRNA ligase
• prolyl-tRNA synthetase
• QARS
• QPRS

Background

Glutamyl Prolyl tRNA synthetase (EPRS) is a component of ARS multi complex. EPRS is released and phosphorylated by IFN stimulation and forms a complex with GAIT.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EPRS