EPPK1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EPPK1 Antibody [NBP2-57158] - Staining of human cell line HeLa shows localization to intermediate filaments.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EPPK1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: STGRFKGCSVSLWDLLLSEYVGADKRRELVALCRSGRAAALRQVVSAVTTLVEAAERQPLQATFRGLRKQVSARDLFRAQLISRKTLDEL
Specificity
Specificity of human EPPK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPPK1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EPPK1 Recombinant Protein Antigen (NBP2-57158PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for EPPK1 Antibody

  • 450 KDa Epidermal Antigen
  • Epidermal Autoantigen 450K
  • EPIPL
  • EPIPL1
  • Epiplakin 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84019
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
AF3075
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-92546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-49306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-45745
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IF
NBP2-93477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-93792
Species: Hu
Applications: IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24653
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-86072
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57158
Species: Hu
Applications: ICC/IF

Publications for EPPK1 Antibody (NBP2-57158) (0)

There are no publications for EPPK1 Antibody (NBP2-57158).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPPK1 Antibody (NBP2-57158) (0)

There are no reviews for EPPK1 Antibody (NBP2-57158). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EPPK1 Antibody (NBP2-57158) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EPPK1 Products

Array NBP2-57158

Bioinformatics Tool for EPPK1 Antibody (NBP2-57158)

Discover related pathways, diseases and genes to EPPK1 Antibody (NBP2-57158). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPPK1 Antibody (NBP2-57158)

Discover more about diseases related to EPPK1 Antibody (NBP2-57158).
 

Pathways for EPPK1 Antibody (NBP2-57158)

View related products by pathway.

Blogs on EPPK1

There are no specific blogs for EPPK1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPPK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPPK1