EPHX2 Antibody

Images

 
Western Blot: EPHX2 Antibody [NBP1-89534] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: EPHX2 Antibody [NBP1-89534] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: EPHX2 Antibody [NBP1-89534] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal centers.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EPHX2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPHX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EPHX2 Protein (NBP1-89534PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EPHX2 Antibody

  • CEH
  • Cytosolic epoxide hydrolase
  • EC 3.3.2.10
  • Epoxide hydratase
  • epoxide hydrolase 2
  • epoxide hydrolase 2, cytoplasmic
  • epoxide hydrolase 2, cytosolic
  • epoxide hydrolase, soluble
  • SEH
  • Soluble epoxide hydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54155
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-29917
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00001551-B01P
Species: Hu
Applications: WB
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP2-45478
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC
NBP2-01286
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89534
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EPHX2 Antibody (NBP1-89534) (0)

There are no publications for EPHX2 Antibody (NBP1-89534).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPHX2 Antibody (NBP1-89534) (0)

There are no reviews for EPHX2 Antibody (NBP1-89534). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EPHX2 Antibody (NBP1-89534) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EPHX2 Products

Bioinformatics Tool for EPHX2 Antibody (NBP1-89534)

Discover related pathways, diseases and genes to EPHX2 Antibody (NBP1-89534). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPHX2 Antibody (NBP1-89534)

Discover more about diseases related to EPHX2 Antibody (NBP1-89534).
 

Pathways for EPHX2 Antibody (NBP1-89534)

View related products by pathway.

PTMs for EPHX2 Antibody (NBP1-89534)

Learn more about PTMs related to EPHX2 Antibody (NBP1-89534).
 

Research Areas for EPHX2 Antibody (NBP1-89534)

Find related products by research area.

Blogs on EPHX2

There are no specific blogs for EPHX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPHX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPHX2