Ephrin-A2 Antibody

Images

 
Western Blot: Ephrin-A2 Antibody [H00001943-B01P] - Analysis of EFNA2 expression in transfected 293T cell line by EFNA2 polyclonal antibody. Lane 1: EFNA2 transfected lysate(23.43 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Ephrin-A2 Antibody Summary

Immunogen
EFNA2 (AAI48728.1, 1 a.a. - 213 a.a.) full-length human protein. MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
EFNA2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ephrin-A2 Antibody

  • Cek7-L
  • EFNA2
  • ELF-1
  • EPH-related receptor tyrosine kinase ligand 6
  • EphrinA2
  • Ephrin-A2
  • EPLG6HEK7 ligand
  • HEK7-L
  • HEK7-ligand
  • LERK6
  • LERK6LERK-6
  • ligand of eph-related kinase 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

374-EA
Species: Hu
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91868
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1069
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
359-EA
Species: Hu
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
MAB3035
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF641
Species: Mu
Applications: WB, IHC
MAB541
Species: Hu, Rt
Applications: WB, Flow, CyTOF-ready, ICC
AF369
Species: Hu
Applications: WB, IHC, ICC
NBP1-84770
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp

Publications for Ephrin-A2 Antibody (H00001943-B01P) (0)

There are no publications for Ephrin-A2 Antibody (H00001943-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ephrin-A2 Antibody (H00001943-B01P) (0)

There are no reviews for Ephrin-A2 Antibody (H00001943-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ephrin-A2 Antibody (H00001943-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ephrin-A2 Products

Bioinformatics Tool for Ephrin-A2 Antibody (H00001943-B01P)

Discover related pathways, diseases and genes to Ephrin-A2 Antibody (H00001943-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ephrin-A2 Antibody (H00001943-B01P)

Discover more about diseases related to Ephrin-A2 Antibody (H00001943-B01P).
 

Pathways for Ephrin-A2 Antibody (H00001943-B01P)

View related products by pathway.

PTMs for Ephrin-A2 Antibody (H00001943-B01P)

Learn more about PTMs related to Ephrin-A2 Antibody (H00001943-B01P).

Blogs on Ephrin-A2

There are no specific blogs for Ephrin-A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ephrin-A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EFNA2
Entrez
Uniprot