Ephrin-A1 Antibody - BSA Free

Staining of human kidney shows moderate extracellular positivity.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ephrin-A1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ephrin-A1 Antibody - BSA Free (NBP3-21329) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EFNA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ephrin-A1 Antibody - BSA Free

• B61
• ECKLG
• EFL1
• EFL-1
• EFNA1
• EPH-related receptor tyrosine kinase ligand 1
• EphrinA1
• Ephrin-A1
• EPLG1TNF alpha-induced protein 4
• Immediate early response protein B61
• LERK1
• LERK1LERK-1
• ligand of eph-related kinase 1
• TNFAIP4B61
• Tumor necrosis factor alpha-induced protein 4
• tumor necrosis factor, alpha-induced protein 4

Background

The Eph subfamily represents the largest group of receptor protein kinases identified to date. There is increasing evidence that Eph family members are involved in central nervous system function and in development. Ligands for Eph receptors include ephrin-A1 (LERK-1/B61), identified as a ligand for the EphA2 (Eck) receptor; ephrin-A2 (ELF-1), identified as a ligand for the EphA3 and EphA4 (Sek) receptors; ephrin-A3 (LERK-3), identified as a ligand for EphA5 (Ehk1) and EphA3 (Hek) receptors; ephrin-A4 (LERK-4), identified as a ligand for the EphA3 receptor; ephrin-A5 (AL-1), identified as a ligand for EphA5 (REK7); ephrin-B1 (LERK-2), identified as a ligand for the EphB1 (Elk) and EphB2 (Cek5) receptors; ephrin-B2 (LERK-5), identified as a ligand for the EphB1, EphB3 (Cek10) and EphB2 receptors; and ephrin-B3 (LERK-8), identified as a ligand for EphB1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EFNA1