Novus Biologicals products are now on bio-techne.com

Ephrin-A1 Antibody (5D4Q5)

Images

 
Western Blot: Ephrin-A1 Antibody (5D4Q5) [NBP3-16761] - Analysis of extracts of HepG2 cells, using Ephrin-A1 antibody (NBP3-16761) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunocytochemistry/ Immunofluorescence: Ephrin-A1 Antibody (5D4Q5) [NBP3-16761] - Immunofluorescence analysis of NIH-3T3 cells using Ephrin-A1 Rabbit mAb (NBP3-16761) at dilution of 1:100 (40x lens). Blue: DAPI for ...read more
Immunohistochemistry-Paraffin: Ephrin-A1 Antibody (5D4Q5) [NBP3-16761] - Human brain using Ephrin-A1 Rabbit mAb (NBP3-16761) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
5D4Q5
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ephrin-A1 Antibody (5D4Q5) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ephrin-A1 (P20827). MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHG
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
EFNA1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 -1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 0.05% BSA, 50% glycerol, pH7.3
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Ephrin-A1 Antibody (5D4Q5)

  • B61
  • ECKLG
  • EFL1
  • EFL-1
  • EFNA1
  • EPH-related receptor tyrosine kinase ligand 1
  • EphrinA1
  • Ephrin-A1
  • EPLG1TNF alpha-induced protein 4
  • Immediate early response protein B61
  • LERK1
  • LERK1LERK-1
  • ligand of eph-related kinase 1
  • TNFAIP4B61
  • Tumor necrosis factor alpha-induced protein 4
  • tumor necrosis factor, alpha-induced protein 4

Background

The Eph subfamily represents the largest group of receptor protein kinases identified to date. There is increasing evidence that Eph family members are involved in central nervous system function and in development. Ligands for Eph receptors include ephrin-A1 (LERK-1/B61), identified as a ligand for the EphA2 (Eck) receptor; ephrin-A2 (ELF-1), identified as a ligand for the EphA3 and EphA4 (Sek) receptors; ephrin-A3 (LERK-3), identified as a ligand for EphA5 (Ehk1) and EphA3 (Hek) receptors; ephrin-A4 (LERK-4), identified as a ligand for the EphA3 receptor; ephrin-A5 (AL-1), identified as a ligand for EphA5 (REK7); ephrin-B1 (LERK-2), identified as a ligand for the EphB1 (Elk) and EphB2 (Cek5) receptors; ephrin-B2 (LERK-5), identified as a ligand for the EphB1, EphB3 (Cek10) and EphB2 receptors; and ephrin-B3 (LERK-8), identified as a ligand for EphB1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3035
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, WB
AF638
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
AF473
Species: Mu
Applications: IHC, Simple Western, WB
8415-A2
Species: Mu
Applications: BA
359-EA
Species: Hu
Applications: Bind
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB369
Species: Hu
Applications: IHC, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF641
Species: Mu
Applications: IHC, WB
DVE00
Species: Hu
Applications: ELISA
AF496
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF4467
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
374-EA
Species: Hu
Applications: Bind
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-16761
Species: Hu, Mu
Applications: WB, ICC/IF, IHC

Publications for Ephrin-A1 Antibody (NBP3-16761) (0)

There are no publications for Ephrin-A1 Antibody (NBP3-16761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ephrin-A1 Antibody (NBP3-16761) (0)

There are no reviews for Ephrin-A1 Antibody (NBP3-16761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ephrin-A1 Antibody (NBP3-16761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ephrin-A1 Products

Research Areas for Ephrin-A1 Antibody (NBP3-16761)

Find related products by research area.

Blogs on Ephrin-A1

There are no specific blogs for Ephrin-A1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ephrin-A1 Antibody (5D4Q5) and receive a gift card or discount.

Bioinformatics

Gene Symbol EFNA1