Ephrin-A1 Antibody (5D4Q5)

Western Blot: Ephrin-A1 Antibody (5D4Q5) [NBP3-16761] - Analysis of extracts of HepG2 cells, using Ephrin-A1 antibody (NBP3-16761) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: Ephrin-A1 Antibody (5D4Q5) [NBP3-16761] - Immunofluorescence analysis of NIH-3T3 cells using Ephrin-A1 Rabbit mAb (NBP3-16761) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: Ephrin-A1 Antibody (5D4Q5) [NBP3-16761] - Human brain using Ephrin-A1 Rabbit mAb (NBP3-16761) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: Ephrin-A1 Antibody (5D4Q5) [NBP3-16761] - Immunofluorescence analysis of NIH-3T3 cells using Ephrin-A1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Ephrin-A1 Antibody (5D4Q5) [Ephrin-A1] - Immunofluorescence analysis of NIH-3T3 cells using Ephrin-A1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 5D4Q5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Ephrin-A1 Antibody (5D4Q5) Summary

• Description: Novus Biologicals Rabbit Ephrin-A1 Antibody (5D4Q5) (NBP3-16761) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ephrin-A1 (P20827). MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHG
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: EFNA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 -1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ephrin-A1 Antibody (5D4Q5)

• B61
• ECKLG
• EFL1
• EFL-1
• EFNA1
• EPH-related receptor tyrosine kinase ligand 1
• EphrinA1
• Ephrin-A1
• EPLG1TNF alpha-induced protein 4
• Immediate early response protein B61
• LERK1
• LERK1LERK-1
• ligand of eph-related kinase 1
• TNFAIP4B61
• Tumor necrosis factor alpha-induced protein 4
• tumor necrosis factor, alpha-induced protein 4

Background

The Eph subfamily represents the largest group of receptor protein kinases identified to date. There is increasing evidence that Eph family members are involved in central nervous system function and in development. Ligands for Eph receptors include ephrin-A1 (LERK-1/B61), identified as a ligand for the EphA2 (Eck) receptor; ephrin-A2 (ELF-1), identified as a ligand for the EphA3 and EphA4 (Sek) receptors; ephrin-A3 (LERK-3), identified as a ligand for EphA5 (Ehk1) and EphA3 (Hek) receptors; ephrin-A4 (LERK-4), identified as a ligand for the EphA3 receptor; ephrin-A5 (AL-1), identified as a ligand for EphA5 (REK7); ephrin-B1 (LERK-2), identified as a ligand for the EphB1 (Elk) and EphB2 (Cek5) receptors; ephrin-B2 (LERK-5), identified as a ligand for the EphB1, EphB3 (Cek10) and EphB2 receptors; and ephrin-B3 (LERK-8), identified as a ligand for EphB1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EFNA1