Ephrin-A1 Antibody (5D4Q5) Summary
| Description |
Novus Biologicals Rabbit Ephrin-A1 Antibody (5D4Q5) (NBP3-16761) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ephrin-A1 (P20827). MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHG |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
EFNA1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 -1:200
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:1000
|
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Ephrin-A1 Antibody (5D4Q5)
Background
The Eph subfamily represents the largest group of receptor protein kinases identified to date. There is increasing evidence that Eph family members are involved in central nervous system function and in development. Ligands for Eph receptors include ephrin-A1 (LERK-1/B61), identified as a ligand for the EphA2 (Eck) receptor; ephrin-A2 (ELF-1), identified as a ligand for the EphA3 and EphA4 (Sek) receptors; ephrin-A3 (LERK-3), identified as a ligand for EphA5 (Ehk1) and EphA3 (Hek) receptors; ephrin-A4 (LERK-4), identified as a ligand for the EphA3 receptor; ephrin-A5 (AL-1), identified as a ligand for EphA5 (REK7); ephrin-B1 (LERK-2), identified as a ligand for the EphB1 (Elk) and EphB2 (Cek5) receptors; ephrin-B2 (LERK-5), identified as a ligand for the EphB1, EphB3 (Cek10) and EphB2 receptors; and ephrin-B3 (LERK-8), identified as a ligand for EphB1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu
Applications: Bind
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
Publications for Ephrin-A1 Antibody (NBP3-16761) (0)
There are no publications for Ephrin-A1 Antibody (NBP3-16761).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Ephrin-A1 Antibody (NBP3-16761) (0)
There are no reviews for Ephrin-A1 Antibody (NBP3-16761).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Ephrin-A1 Antibody (NBP3-16761) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Ephrin-A1 Products
Research Areas for Ephrin-A1 Antibody (NBP3-16761)
Find related products by research area.
|
Blogs on Ephrin-A1