EphB6 Antibody (5D8)

Images

 
Western Blot: EphB6 Antibody (5D8) [H00002051-M03] - Analysis of EPHB6 expression in NIH/3T3 (Cat # L018V1).
Immunohistochemistry-Paraffin: EphB6 Antibody (5D8) [H00002051-M03] - Analysis of monoclonal antibody to EPHB6 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 3 ug/ml
Western Blot: EphB6 Antibody (5D8) [H00002051-M03] - Analysis of EPHB6 expression in PC-12 (Cat # L012V1).
ELISA: EphB6 Antibody (5D8) [H00002051-M03] - Detection limit for recombinant GST tagged EPHB6 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
5D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EphB6 Antibody (5D8) Summary

Immunogen
EPHB6 (NP_004436, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEE
Specificity
EPHB6 - EPH receptor B6
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EPHB6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Reviewed Applications
Read 1 Review rated 4
using
H00002051-M03 in the following applications:

Publications
Read Publication using H00002051-M03.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EphB6 Antibody (5D8)

  • EC 2.7.10.1
  • EPH receptor B6
  • EphB6
  • ephrin type-B receptor 6
  • Hep
  • HEPTyrosine-protein kinase-defective receptor EPH-6
  • Mep
  • MGC129910
  • MGC129911

Background

Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The ephrin receptor encoded by this gene lacks the kinase activity of most receptor tyrosine kinases and binds to ephrin-B ligands.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-60616
Species: Hu
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-26190
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
7270-IL/CF
Species: Hu
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-67764
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89703
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD

Publications for EphB6 Antibody (H00002051-M03)(1)

Review for EphB6 Antibody (H00002051-M03) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00002051-M03:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot EphB6 H00002051-M03
Enlarge
4
reviewed by:
Diego Arango
WB Human 01/13/2012
View

Summary

ApplicationWestern Blot
Sample TestedSW480 whole cell lysate, Sample Amount: 100ug
SpeciesHuman
CommentsNice and strong specific band. Good antibody for WB.

Blocking

Blocking DetailsBlocking Buffer: 5% Milk in PBST, Blocking Time: 1 hour, Blocking Temp: Room temperature

Primary Anitbody

Dilution RatioDilution Ratio: 1:1000, Incubation Dilution Buffer: 5% milk, Incubation Time: overnight, Incubation Temp: 4 C

Secondary Antibody

Secondary DescriptionSecondary Ab: DAKO Polyclonal Goat Anti-Mouse Immunoglobulins/HRP (P 0447), Secondary Ab Dilution Ratio: 1:5000

Details

Detection NotesMethod:ECL,Time:2min,PosCtrl:HEK293 cells transfected w/ human EPHB6,NegCtrl:shEPHB6 transfected colon cancer cells,Band:110kDa

Comments

CommentsNice and strong specific band. Good antibody for WB.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EphB6 Antibody (H00002051-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EphB6 Products

Bioinformatics Tool for EphB6 Antibody (H00002051-M03)

Discover related pathways, diseases and genes to EphB6 Antibody (H00002051-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EphB6 Antibody (H00002051-M03)

Discover more about diseases related to EphB6 Antibody (H00002051-M03).
 

Pathways for EphB6 Antibody (H00002051-M03)

View related products by pathway.

PTMs for EphB6 Antibody (H00002051-M03)

Learn more about PTMs related to EphB6 Antibody (H00002051-M03).
 

Research Areas for EphB6 Antibody (H00002051-M03)

Find related products by research area.

Blogs on EphB6

There are no specific blogs for EphB6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Diego Arango
01/13/2012
Application: WB
Species: Human

Bioinformatics

Gene Symbol EPHB6
Entrez
OMIM
Uniprot