EphA3 Antibody (3A12)

Images

 
Western Blot: EphA3 Antibody (3A12) [H00002042-M01] - EPHA3 monoclonal antibody (M01), clone 3A12. Analysis of EPHA3 expression in human spleen.
Western Blot: EphA3 Antibody (3A12) [H00002042-M01] - analysis of EPHA3 expression in transfected 293T cell line by EPHA3 monoclonal antibody (M01), clone 3A12. Lane 1: EPHA3 transfected lysate (110.1 KDa). Lane 2: ...read more
Western Blot: EphA3 Antibody (3A12) [H00002042-M01] - Analysis of EPHA3 over-expressed 293 cell line, cotransfected with EPHA3 Validated Chimera RNAi ( Cat # H00002042-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Sandwich ELISA: EphA3 Antibody (3A12) [H00002042-M01] - Detection limit for recombinant GST tagged EPHA3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi
Clone
3A12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EphA3 Antibody (3A12) Summary

Immunogen
EPHA3 (AAH63282 202 a.a. - 326 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPP
Specificity
EPHA3 - EPH receptor A3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EPHA3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.
Publications
Read Publication using H00002042-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EphA3 Antibody (3A12)

  • Cek4
  • EC 2.7.10
  • EC 2.7.10.1
  • EK4
  • EPH receptor A3
  • EphA3
  • EPH-like kinase 4
  • ephrin type-A receptor 3
  • ETK
  • Hek4
  • HEKETK1eph-like tyrosine kinase 1
  • human embryo kinase 1
  • TYRO4 protein tyrosine kinase
  • Tyro4
  • Tyrosine-protein kinase receptor ETK1
  • Tyrosine-protein kinase TYRO4

Background

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Two alternatively spliced transcript variants have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-56655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF5887
Species: Hu
Applications: WB, IHC
NBL1-12154
Species: Hu
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00002042-M01
Species: Hu
Applications: WB, ELISA, RNAi

Publications for EPH Receptor A3 Antibody (H00002042-M01)(1)

Reviews for EPH Receptor A3 Antibody (H00002042-M01) (0)

There are no reviews for EPH Receptor A3 Antibody (H00002042-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EPH Receptor A3 Antibody (H00002042-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EphA3 Products

Bioinformatics Tool for EPH Receptor A3 Antibody (H00002042-M01)

Discover related pathways, diseases and genes to EPH Receptor A3 Antibody (H00002042-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPH Receptor A3 Antibody (H00002042-M01)

Discover more about diseases related to EPH Receptor A3 Antibody (H00002042-M01).
 

Pathways for EPH Receptor A3 Antibody (H00002042-M01)

View related products by pathway.

PTMs for EPH Receptor A3 Antibody (H00002042-M01)

Learn more about PTMs related to EPH Receptor A3 Antibody (H00002042-M01).
 

Research Areas for EPH Receptor A3 Antibody (H00002042-M01)

Find related products by research area.

Blogs on EphA3

There are no specific blogs for EphA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EphA3 Antibody (3A12) and receive a gift card or discount.

Bioinformatics

Gene Symbol EPHA3
Entrez
OMIM
Uniprot