Recombinant Human EpCAM/TROP1 Protein

Product Discontinued

Recombinant Human EpCAM/TROP1 Protein Summary

• Description: An untagged recombinant protein corresponding to the amino acid sequence of (NP_002345.1) for Human EpCAM/TROP1
  
  

  Source: Wheat Germ

  Amino Acid Sequence: MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA

• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: EPCAM
• Purity: >5% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Immunoaffinity Purification
• Theoretical MW: 34.9 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 25 mM Tris-HCl pH8.0 in 2% glycerol.
• Preservative: No Preservative
• Purity: >5% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EpCAM/TROP1 Protein

• 17-1A
• 323/A3
• ACSTD1
• antigen identified by monoclonal AUA1
• CD326 antigen
• CD326
• Cell surface glycoprotein Trop-1
• chromosome 4, surface marker (35kD glycoprotein)
• DIAR5
• EGP
• EGP-2
• EGP314
• EGP40
• EpCAM
• epithelial cell adhesion molecule
• Epithelial cell surface antigen
• Epithelial glycoprotein 314
• Epithelial glycoprotein
• ESA
• GA733-2
• GA733-2EGP34
• gp40
• hEGP314
• HNPCC8
• KS 1/4 antigen
• KS1/4
• KSAHEA125
• M1S2
• M4S1
• M4S1Ly74
• Major gastrointestinal tumor-associated protein GA733-2
• MIC18MH99
• MOC31
• TACST-1
• TACSTD1
• TROP1
• TROP1CD326
• Tumor-associated calcium signal transducer 1CO-17A

Background

Epithelial cell adhesion molecule (EpCAM), also known as TROP1 and CD326, is a type I transmembrane glycoprotein that plays a role in a number of cellular processes including adhesion, signaling, maintaining stemness, proliferation, migration, and invasion (1,2). The human EpCAM protein is 314 amino acids (aa) in length with a theoretical molecular weight (MW) of ~35 kDa (1,3,4). The EpCAM protein includes a signal peptide, an extracellular N-terminal domain, a thyroglobulin type-1 domain, a carboxyl-terminal domain, a single-pass transmembrane domain, and an intracellular domain (1,3). The protein is highly conserved and has approximately 81% aa sequence identity between human and mouse (5). Trophoblast cell-surface antigen 2 (TROP2) also shares ~67% aa sequence similarity with EpCAM (1,5). While both EpCAM and TROP2 are cell surface markers expressed in the epithelium, their expression levels typically do not correlate (5). EpCAM is expressed in normal epithelial tissue and elevated expression is observed in many epithelial carcinomas (1-3) Patient tumor samples with increased EpCAM expression have been associated with poor prognosis (1). Given EpCAM's elevated expression in tumors, it has become a potential target for cancer therapy approaches, including monoclonal antibody treatment and anti-EpCAM trispecific antibodies (1,5).

EpCAM functions as an intracellular signaling molecule and contributes to regulation of epithelial-to-mesenchymal (EMT) transition (4,5). EpCAM is cleaved during the process of regulated intramembrane proteolysis (RIP) (4,5). Initial cleavage occurs at the membrane via a disintegrin and metalloprotease 17 (ADAM17) which releases EpCAM's extracellular domain (EpEx) (4,5). A secondary cleavage is mediated by presenilin 2 (PSEN2) which releases EpCAM's cytoplasmic trail (EpICD) (4,5). EpICD translocates to the nucleus where it associates with beta-catenin, FHL-2, and LEF-1 and induces transcription of genes related to EMT and tumor growth (4,5). EpCAM has also been shown to regulate structure and functionality of the apical junction complex of cells through direct interaction with claudin-7 and association with E-cadherin (2,5). Loss of EpCAM disrupts adherins junction and tight junction structure and function (2).

References

1. Mohtar MA, Syafruddin SE, Nasir SN, Low TY. Revisiting the Roles of Pro-Metastatic EpCAM in Cancer. Biomolecules. 2020; 10(2):255. https://doi.org/10.3390/biom10020255

2. Huang L, Yang Y, Yang F, et al. Functions of EpCAM in physiological processes and diseases (Review). Int J Mol Med. 2018; 42(4):1771-1785. https://doi.org/10.3892/ijmm.2018.3764

3. Brown TC, Sankpal NV, Gillanders WE. Functional Implications of the Dynamic Regulation of EpCAM during Epithelial-to-Mesenchymal Transition. Biomolecules. 2021; 11(7):956. https://doi.org/10.3390/biom11070956

4. Uniprot (P16422)

5. Schnell U, Cirulli V, Giepmans BN. EpCAM: structure and function in health and disease. Biochim Biophys Acta. 2013; 1828(8):1989-2001. https://doi.org/10.1016/j.bbamem.2013.04.018

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for EpCAM/TROP1 Recombinant Protein (H00004072-G01). (Showing 1 - 1 of 1 FAQ).

1. I'm looking for EpCAM antibody for rat. Do you have any antibody which can use FACS?
   • We unfortunately do not have any EpCAM antibodies validated in FACS for detection of the rat protein. I am sorry for any inconvenience. I do have three products to EpCAM that can detect the rat protein. These products have been validated to detect the native rat protein, so they may work for FACS however they have not yet been tested in that particular application. If you would like to try them in your experiment you would qualify for our Innovator's Reward Program. This program was designed to help scientists with the cost of their antibodies in return for valuable information. If you decide to test an antibody in a previously untested species or application we will issue you a credit for the purchase price of the antibody in exchange for a review of your experiment using our product.

Bioinformatics

• Gene Symbol: EPCAM