EpCAM/TROP1 Antibody


Immunocytochemistry/ Immunofluorescence: EpCAM/TROP1 Antibody [NBP2-56894] - Staining of human cell line MCF7 shows localization to plasma membrane.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

EpCAM/TROP1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQN
Specificity of human EpCAM/TROP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EpCAM/TROP1 Recombinant Protein Antigen (NBP2-56894PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for EpCAM/TROP1 Antibody

  • 17-1A
  • 323/A3
  • ACSTD1
  • antigen identified by monoclonal AUA1
  • CD326 antigen
  • CD326
  • Cell surface glycoprotein Trop-1
  • chromosome 4, surface marker (35kD glycoprotein)
  • DIAR5
  • EGP
  • EGP-2
  • EGP314
  • EGP40
  • EpCAM
  • epithelial cell adhesion molecule
  • Epithelial cell surface antigen
  • Epithelial glycoprotein 314
  • Epithelial glycoprotein
  • ESA
  • GA733-2
  • GA733-2EGP34
  • gp40
  • hEGP314
  • HNPCC8
  • KS 1/4 antigen
  • KS1/4
  • KSAHEA125
  • M1S2
  • M4S1
  • M4S1Ly74
  • Major gastrointestinal tumor-associated protein GA733-2
  • MIC18MH99
  • MOC31
  • TACST-1
  • TROP1
  • TROP1CD326
  • Tumor-associated calcium signal transducer 1CO-17A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready

Publications for EpCAM/TROP1 Antibody (NBP2-56894) (0)

There are no publications for EpCAM/TROP1 Antibody (NBP2-56894).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EpCAM/TROP1 Antibody (NBP2-56894) (0)

There are no reviews for EpCAM/TROP1 Antibody (NBP2-56894). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EpCAM/TROP1 Antibody (NBP2-56894). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for EpCAM antibody for rat. Do you have any antibody which can use FACS?
    • We unfortunately do not have any EpCAM antibodies validated in FACS for detection of the rat protein. I am sorry for any inconvenience. I do have three products to EpCAM that can detect the rat protein. These products have been validated to detect the native rat protein, so they may work for FACS however they have not yet been tested in that particular application. If you would like to try them in your experiment you would qualify for our Innovator's Reward Program. This program was designed to help scientists with the cost of their antibodies in return for valuable information. If you decide to test an antibody in a previously untested species or application we will issue you a credit for the purchase price of the antibody in exchange for a review of your experiment using our product.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional EpCAM/TROP1 Products

Bioinformatics Tool for EpCAM/TROP1 Antibody (NBP2-56894)

Discover related pathways, diseases and genes to EpCAM/TROP1 Antibody (NBP2-56894). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EpCAM/TROP1 Antibody (NBP2-56894)

Discover more about diseases related to EpCAM/TROP1 Antibody (NBP2-56894).

Pathways for EpCAM/TROP1 Antibody (NBP2-56894)

View related products by pathway.

PTMs for EpCAM/TROP1 Antibody (NBP2-56894)

Learn more about PTMs related to EpCAM/TROP1 Antibody (NBP2-56894).

Research Areas for EpCAM/TROP1 Antibody (NBP2-56894)

Find related products by research area.

Blogs on EpCAM/TROP1.

Stemness is responsible for onset and metastasis of colorectal cancer
By Jamshed Arslan, Pharm. D., PhD. Colorectal cancer stem cells are a rare subpopulation of colorectal cancer cells that can self-renew and initiate and sustain tumor growth when transplanted into an animal host.1,2 C...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EpCAM/TROP1 Antibody and receive a gift card or discount.


Gene Symbol EPCAM