Recombinant Human EOMES Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EOMES Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 547-645 of Human EOMES partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EOMES
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EOMES Protein

  • EOMES
  • eomesodermin (Xenopus laevis) homolog
  • Eomesodermin
  • t box, brain, 2
  • T-box brain protein 2
  • T-box brain2
  • TBR2
  • TBR-2
  • TBR2eomesodermin homolog
  • T-brain-2

Background

This gene encodes a member of a conserved protein family that shares a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. A similiar gene disrupted in mice is shown to be essential during trophoblast development and gastrulation. EOMES( NP_005433, 547 a.a. - 646 a.a.) partial recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00010716-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46076
Species: Hu
Applications: WB, IHC
594-ML/CF
Species: Mu

Publications for EOMES Partial Recombinant Protein (H00008320-Q01) (0)

There are no publications for EOMES Partial Recombinant Protein (H00008320-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EOMES Partial Recombinant Protein (H00008320-Q01) (0)

There are no reviews for EOMES Partial Recombinant Protein (H00008320-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EOMES Partial Recombinant Protein (H00008320-Q01). (Showing 1 - 1 of 1 FAQ).

  1. Please supply a list of eomes antibodies
    • Here is a link to all of our EOMES antibodies

Additional EOMES Products

Bioinformatics Tool for EOMES Partial Recombinant Protein (H00008320-Q01)

Discover related pathways, diseases and genes to EOMES Partial Recombinant Protein (H00008320-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EOMES Partial Recombinant Protein (H00008320-Q01)

Discover more about diseases related to EOMES Partial Recombinant Protein (H00008320-Q01).
 

Pathways for EOMES Partial Recombinant Protein (H00008320-Q01)

View related products by pathway.

PTMs for EOMES Partial Recombinant Protein (H00008320-Q01)

Learn more about PTMs related to EOMES Partial Recombinant Protein (H00008320-Q01).

Blogs on EOMES

There are no specific blogs for EOMES, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF
EOMES Antibody
NBP1-80699

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EOMES Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EOMES
Entrez