EOMES Antibody (1A8)

Images

 
Western Blot: EOMES Antibody (1A8) [H00008320-M12] - Analysis of EOMES expression in IMR-32 (Cat # L008V1).
Sandwich ELISA: EOMES Antibody (1A8) [H00008320-M12] - Detection limit for recombinant GST tagged EOMES is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EOMES Antibody (1A8) Summary

Immunogen
EOMES (NP_005433.2 461 a.a. - 569 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTF
Specificity
EOMES (1A8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EOMES
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EOMES Antibody (1A8)

  • EOMES
  • eomesodermin (Xenopus laevis) homolog
  • Eomesodermin
  • t box, brain, 2
  • T-box brain protein 2
  • T-box brain2
  • TBR2
  • TBR-2
  • TBR2eomesodermin homolog
  • T-brain-2

Background

This gene encodes a member of a conserved protein family that shares a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. A similiar gene disrupted in mice is shown to be essential during trophoblast development and gastrulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00010716-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46076
Species: Hu
Applications: WB, IHC
594-ML/CF
Species: Mu

Publications for EOMES Antibody (H00008320-M12) (0)

There are no publications for EOMES Antibody (H00008320-M12).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EOMES Antibody (H00008320-M12) (0)

There are no reviews for EOMES Antibody (H00008320-M12). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EOMES Antibody (H00008320-M12). (Showing 1 - 1 of 1 FAQ).

  1. Please supply a list of eomes antibodies
    • Here is a link to all of our EOMES antibodies

Secondary Antibodies

 

Isotype Controls

Additional EOMES Products

Bioinformatics Tool for EOMES Antibody (H00008320-M12)

Discover related pathways, diseases and genes to EOMES Antibody (H00008320-M12). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EOMES Antibody (H00008320-M12)

Discover more about diseases related to EOMES Antibody (H00008320-M12).
 

Pathways for EOMES Antibody (H00008320-M12)

View related products by pathway.

PTMs for EOMES Antibody (H00008320-M12)

Learn more about PTMs related to EOMES Antibody (H00008320-M12).

Blogs on EOMES

There are no specific blogs for EOMES, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EOMES Antibody (1A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol EOMES
Entrez
OMIM
Uniprot