Enteropeptidase/Enterokinase Antibody

Images

 
Western Blot: Enterokinase Antibody [NBP1-87949] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: Enterokinase Antibody [NBP1-87949] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Enteropeptidase/Enterokinase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:INDVVEIRDGEEADSLLLAVYTGPGPVKDVFSTTNRMTVLLITNDVLARGGFKANFTTGYHLGIPEPCKADHFQCKNGECVPLVNLCDGHLHCEDGSDEADCVRFFNGTTNNNGLVRFRIQSIWHTACAENWT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMPRSS15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Enteropeptidase/Enterokinase Protein (NBP1-87949PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Enteropeptidase/Enterokinase Antibody

  • EC 3.4.21
  • EC 3.4.21.9
  • Enterokinase
  • Enteropeptidase
  • ENTK
  • ENTKenterokinase
  • MGC133046
  • protease, serine, 7 (enterokinase)
  • PRSS7
  • PRSS7enteropeptidase
  • Serine protease 7
  • TMPRSS15
  • Transmembrane protease serine 15
  • transmembrane protease, serine 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF3848
Species: Hu
Applications: WB, IHC, IP
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB3586
Species: Hu
Applications: WB, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-50509
Species: Hu
Applications: IHC, IP
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
H00055697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
AF3565
Species: Mu
Applications: WB, IHC, IP
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-87949
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Enteropeptidase/Enterokinase Antibody (NBP1-87949) (0)

There are no publications for Enteropeptidase/Enterokinase Antibody (NBP1-87949).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Enteropeptidase/Enterokinase Antibody (NBP1-87949) (0)

There are no reviews for Enteropeptidase/Enterokinase Antibody (NBP1-87949). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Enteropeptidase/Enterokinase Antibody (NBP1-87949) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Enteropeptidase/Enterokinase Products

Bioinformatics Tool for Enteropeptidase/Enterokinase Antibody (NBP1-87949)

Discover related pathways, diseases and genes to Enteropeptidase/Enterokinase Antibody (NBP1-87949). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for Enteropeptidase/Enterokinase Antibody (NBP1-87949)

Find related products by research area.

Blogs on Enteropeptidase/Enterokinase

There are no specific blogs for Enteropeptidase/Enterokinase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Enteropeptidase/Enterokinase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMPRSS15
Entrez