ENPP-5 Antibody

Images

 
Immunohistochemistry: ENPP-5 Antibody [NBP1-86449] - Staining of human testis shows strong cytoplasmic positivity in cells of ductus seminiferus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ENPP-5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KFWEEATPIWITNQRAGHTSGAAMWPGTDVKIHKRFPTHYMPYNESVSFEDRVAKIIEWFTSKEPINLGLLYWEDPDDMGHHLGPDSPLMGPVISDIDKKLGYLIQMLKKAKLWNTLNLIITSDHGMTQCSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ENPP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ENPP-5 Protein (NBP1-86449PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ENPP-5 Antibody

  • EC 3.1
  • ectonucleotide pyrophosphatase/phosphodiesterase 5 (putative function)
  • ectonucleotide pyrophosphatase/phosphodiesterase 5 (putative)
  • ectonucleotide pyrophosphatase/phosphodiesterase family member 5
  • E-NPP 5
  • ENPP5
  • ENPP-5
  • KIAA0879
  • NPP5
  • NPP-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-93322
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-15131
Species: Hu
Applications: WB
NBP1-31632
Species: Hu
Applications: WB, ICC/IF
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP2-30684
Species: Hu
Applications: IHC, IHC-P
NBP2-13408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59840
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-48030
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76926
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-90071
Species: Hu, Mu, Po, Eq
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28912
Species: Hu
Applications: WB, PEP-ELISA
NBP1-90592
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-06661
Species: Hu
NBP1-82960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14249
Species: Hu
Applications: IHC, IHC-P

Publications for ENPP-5 Antibody (NBP1-86449) (0)

There are no publications for ENPP-5 Antibody (NBP1-86449).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ENPP-5 Antibody (NBP1-86449) (0)

There are no reviews for ENPP-5 Antibody (NBP1-86449). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ENPP-5 Antibody (NBP1-86449) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ENPP-5 Products

Bioinformatics Tool for ENPP-5 Antibody (NBP1-86449)

Discover related pathways, diseases and genes to ENPP-5 Antibody (NBP1-86449). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ENPP-5 Antibody (NBP1-86449)

Discover more about diseases related to ENPP-5 Antibody (NBP1-86449).
 

Pathways for ENPP-5 Antibody (NBP1-86449)

View related products by pathway.

PTMs for ENPP-5 Antibody (NBP1-86449)

Learn more about PTMs related to ENPP-5 Antibody (NBP1-86449).

Blogs on ENPP-5

There are no specific blogs for ENPP-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ENPP-5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ENPP5
Entrez