ENPP-2/Autotaxin Antibody - BSA Free

Western Blot: ENPP2 Antibody [NBP1-59852] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ENPP-2/Autotaxin Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ENPP2 (ectonucleotide pyrophosphatase/phosphodiesterase 2) The peptide sequence was selected from the N terminal of ENPP2)(50ug). Peptide sequence YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ENPP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 95 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ENPP-2/Autotaxin Antibody - BSA Free

• ATX
• ATXFLJ26803
• ATX-X
• Autotaxin
• autotaxin-t
• EC 3.1.4.39
• ectonucleotide pyrophosphatase/phosphodiesterase 2
• ectonucleotide pyrophosphatase/phosphodiesterase family member 2
• E-NPP 2
• ENPP2
• ENPP-2
• Extracellular lysophospholipase D
• Lysophosphatidic Acid
• LysoPLD
• NPP2
• PD-IALPHA
• PDNP2
• PDNP2NPP2
• phosphodiesterase I/nucleotide pyrophosphatase 2
• plasma lysophospholipase D

Background

The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas. The gene product is secreted and further processed to make the biologically active form. Several alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ENPP2
• Uniprot:
  • Q13822()