![Immunohistochemistry-Paraffin: ENPP6 Antibody [NBP1-82710] - Staining of human testis shows weak membranous positivity in subset of cells in seminiferous ducts.](http://images.novusbio.com/fullsize/ENPP6-Antibody-Immunohistochemistry-Paraffin-NBP1-82710-img0006.jpg "Immunohistochemistry-Paraffin: ENPP6 Antibody [NBP1-82710] - Staining of human testis shows weak membranous positivity in subset of cells in seminiferous ducts.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVNKDSLMPLWWNGS |
| Predicted Species | Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ENPP6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for ENPP6 Antibody (NBP1-82710)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ENPP6 |
![Immunohistochemistry-Paraffin: ENPP6 Antibody [NBP1-82710] - Staining of human cerebral cortex shows moderate positivity in neuronal processes in neuropil.](http://images.novusbio.com/fullsize/ENPP6-Antibody-Immunohistochemistry-Paraffin-NBP1-82710-img0003.jpg "Immunohistochemistry-Paraffin: ENPP6 Antibody [NBP1-82710] - Staining of human cerebral cortex shows moderate positivity in neuronal processes in neuropil.")
![Immunohistochemistry-Paraffin: ENPP6 Antibody [NBP1-82710] - Staining of human kidney shows weak membranous and granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/ENPP6-Antibody-Immunohistochemistry-Paraffin-NBP1-82710-img0004.jpg "Immunohistochemistry-Paraffin: ENPP6 Antibody [NBP1-82710] - Staining of human kidney shows weak membranous and granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: ENPP6 Antibody [NBP1-82710] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/ENPP6-Antibody-Immunohistochemistry-Paraffin-NBP1-82710-img0005.jpg "Immunohistochemistry-Paraffin: ENPP6 Antibody [NBP1-82710] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")