ENPP6 Antibody

Images

 
Immunohistochemistry-Paraffin: ENPP6 Antibody [NBP1-82710] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ENPP6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVNKDSLMPLWWNGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ENPP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ENPP6 Protein (NBP1-82710PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ENPP6 Antibody

  • B830047L21Rik
  • EC 3.1
  • ectonucleotide pyrophosphatase/phosphodiesterase 6
  • ectonucleotide pyrophosphatase/phosphodiesterase family member 6
  • E-NPP 6
  • ENPP6
  • ENPP-6
  • GPC-Cpde
  • MGC33971
  • NPP6
  • NPP-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
8996-EN
Species: Mu
H00023049-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF5160
Species: Mu
Applications: WB, IHC, IP
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-89265
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-70402
Species: Hu
Applications: WB
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90071
Species: Hu, Mu, Po, Eq
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16861
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-90089
Species: Hu
Applications: IHC, IHC-P

Publications for ENPP6 Antibody (NBP1-82710) (0)

There are no publications for ENPP6 Antibody (NBP1-82710).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ENPP6 Antibody (NBP1-82710) (0)

There are no reviews for ENPP6 Antibody (NBP1-82710). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ENPP6 Antibody (NBP1-82710) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ENPP6 Products

Bioinformatics Tool for ENPP6 Antibody (NBP1-82710)

Discover related pathways, diseases and genes to ENPP6 Antibody (NBP1-82710). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ENPP6 Antibody (NBP1-82710)

Discover more about diseases related to ENPP6 Antibody (NBP1-82710).
 

Pathways for ENPP6 Antibody (NBP1-82710)

View related products by pathway.

Research Areas for ENPP6 Antibody (NBP1-82710)

Find related products by research area.

Blogs on ENPP6

There are no specific blogs for ENPP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ENPP6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ENPP6
Entrez