Enolase 2/Neuron-specific Enolase Antibody (SPM347) Summary
| Description |
200ug/ml of antibody purified from Bioreactor Concentrate by Protein A or G. Prepared in 10 mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0 mg/ml. (NBP2-54590)
Antibody with azide - store at 2 to 8C. Antibody without azide - store at -20 to -80C. |
| Immunogen |
A synthetic peptide of human Enolase 2/Neuron-specific Enolase (around aa416-433; exact sequence is proprietary) (Uniprot: P09104) |
| Localization |
Cytoplasmic |
| Marker |
Neuroendocrine Marker |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
ENO2 |
| Purity |
Protein A or G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Flow Cytometry 1-2 ug/million cells
- Immunocytochemistry/ Immunofluorescence 1-2 ug/ml
- Immunohistochemistry
- Immunohistochemistry-Paraffin 0.1-0.2 ug/ml
- Western Blot 1-2 ug/ml
|
| Application Notes |
Immunohistochemistry (Formalin-fixed): 0.1-0.2ug/ml for 30 min at RT. Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95C followed by cooling at RT for 20 minutes. Optimal dilution for a specific application should be determined. |
| Theoretical MW |
50 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C. |
| Buffer |
10 mM PBS with 0.05% BSA |
| Preservative |
0.05% Sodium Azide |
| Concentration |
0.2 mg/ml |
| Purity |
Protein A or G purified |
Alternate Names for Enolase 2/Neuron-specific Enolase Antibody (SPM347)
Background
Neuron-specific enolase (NSE) is a glycolytic isoenzyme which is located in central and peripheral neurons and neuroendocrine cells. This enzyme is released into the CSF when neural tissue is injured. Neoplasms derived from neural or neuroendocrine tissue may release NSE into the blood. NSE is a useful substance that has been detected in patients with certain tumors, namely: neuroblastoma, small cell lung cancer, medullary thyroid cancer, carcinoid tumors, pancreatic endocrine tumors, and melanoma. Recombinant NSE was expressed in E.coli and purified by conventional chromatography techniques.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Hu
Applications: WB, Flow, ICC/IF, IHC
Publications for Enolase 2/Neuron-specific Enolase Antibody (NBP2-53158) (0)
There are no publications for Enolase 2/Neuron-specific Enolase Antibody (NBP2-53158).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Enolase 2/Neuron-specific Enolase Antibody (NBP2-53158) (0)
There are no reviews for Enolase 2/Neuron-specific Enolase Antibody (NBP2-53158).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Enolase 2/Neuron-specific Enolase Antibody (NBP2-53158). (Showing 1 - 1 of 1 FAQ).
-
Enolase came up as a candidate in mass spec. There are at least three isoforms which showed up once or twice or three times (as in three mass spec repeats). To validate the mass data, we are looking into quantitate each isoform. Which antibodies are specific for each of the three?
- We checked all antibodies to Enolase 1, Enolase 2 and Enolase 3, but unfortunately no cross reactivity testing was performed for any of these antibodies. Considering how similar these proteins are, it is reasonable to expect some of them will react with other enolases. Base on immunogen sequence, we found some that were raised to the most diverse regions between these proteins, so it is possible that these will be the most specific to the protein they were raised to.For Enolase 1, your best bet is NBP2-25147 as it was raised to N terminal peptide of bovine Eno1: MSILKVHAREIFFor Enolase 2, I found 3 candidate antibodies:NBP2-53158 and NBP2-50532 were raised to aa416-433 (ELGDEARFAGHNFRNPSVL) - it says these antibodies are only reactive with human but they will also work for mouse since the immunogen is 100% matchNBP2-50533, which was raised to aa271-285 (GDQLGALYQDFVRD) - which is also likely to react with mouse, the immunogen is 93% match with mouse (only last aminoacid is different)For Enolase 3, your best bet would be H00002027-M01 or H00002027-A01. both were raised to aa228-277 (KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG) - 98% match to mouseThe immunogens for all these antibodies fall into most variable regions, however, since we have not performed crossreactivity testing, we can not guarantee that they will not crossreact to some extent.
Secondary Antibodies
| |
Isotype Controls
|
Additional Enolase 2/Neuron-specific Enolase Products
Research Areas for Enolase 2/Neuron-specific Enolase Antibody (NBP2-53158)
Find related products by research area.
|
Blogs on Enolase 2/Neuron-specific Enolase