Enolase 2/Neuron-specific Enolase Antibody (SPM347)

Immunohistochemistry-Paraffin: Enolase 2/Neuron-specific Enolase Antibody (SPM347) [NBP2-53158] - Formalin-fixed, paraffin-embedded Human Pheochromocytoma stained with NSE gamma Monoclonal Antibody (SPM347).

• Reactivity: Hu
• Applications: WB, Flow, ICC/IF, IHC, IHC-P
• Clone: SPM347
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Concentration: 0.2 mg/ml

Enolase 2/Neuron-specific Enolase Antibody (SPM347) Summary

• Immunogen: A synthetic peptide corresponding to aa416-433 of human NSE gamma (exact sequence is proprietary)
• Localization: Cytoplasmic
• Marker: Neuroendocrine Marker
• Isotype: IgG2b
• Clonality: Monoclonal
• Host: Mouse
• Gene: ENO2
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.5 - 1 ug/ml
  • Flow Cytometry 0.5 - 1 ug/million cells
  • Immunocytochemistry/Immunofluorescence 1 - 2 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 0.1 - 0.2 ug/ml
• Application Notes: IHC-P: Staining of formalin-fixed tissues requires boiling tissue sections in 10mM Citrate Buffer pH 6.0 for 10-20 min followed by cooling at RT for 20 minutes
• Theoretical MW: 50 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C.
• Buffer: 10 mM PBS with 0.05% BSA
• Preservative: 0.05% Sodium Azide
• Concentration: 0.2 mg/ml
• Purity: Protein A or G purified

Alternate Names for Enolase 2/Neuron-specific Enolase Antibody (SPM347)

• 2-phospho-D-glycerate hydrolyase
• 2-phospho-D-glycerate hydro-lyase
• EC 4.2.1.11
• ENO2
• enolase 2 (gamma, neuronal)
• Enolase 2
• gamma-Enolase
• Neural enolase
• neuron specific gamma enolase
• neurone-specific enolase
• Neuronspecific Enolase
• Neuron-specific enolase
• NSE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Enolase 2/Neuron-specific Enolase Antibody (NBP2-53158). (Showing 1 - 1 of 1 FAQ).

1. Enolase came up as a candidate in mass spec. There are at least three isoforms which showed up once or twice or three times (as in three mass spec repeats). To validate the mass data, we are looking into quantitate each isoform. Which antibodies are specific for each of the three?
   • We checked all antibodies to Enolase 1, Enolase 2 and Enolase 3, but unfortunately no cross reactivity testing was performed for any of these antibodies. Considering how similar these proteins are, it is reasonable to expect some of them will react with other enolases. Base on immunogen sequence, we found some that were raised to the most diverse regions between these proteins, so it is possible that these will be the most  specific to the protein they were raised to.For Enolase 1, your best bet is NBP2-25147  as it was raised to N terminal peptide of bovine Eno1: MSILKVHAREIFFor Enolase 2, I found 3 candidate antibodies:NBP2-53158  and NBP2-50532  were raised to aa416-433 (ELGDEARFAGHNFRNPSVL) - it says these antibodies are only reactive with human but they will also work for mouse since the immunogen is 100% matchNBP2-50533, which was raised to aa271-285 (GDQLGALYQDFVRD) - which is also likely to react with mouse, the immunogen is 93% match with mouse (only last aminoacid is different)For Enolase 3, your best bet would be H00002027-M01 or H00002027-A01. both were raised to aa228-277 (KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG) - 98% match to mouseThe immunogens for all these antibodies fall into most variable regions, however, since we have not performed crossreactivity testing, we can not guarantee that they will not crossreact to some extent.

Bioinformatics

• Gene Symbol: ENO2