Enolase 2/Neuron-specific Enolase Antibody (NSEP2) - BSA Free

Western Blot: Enolase 2/Neuron-specific Enolase Antibody (NSEP2) [NBP2-50533] - Lysates were separated on SDS-PAGE and probed with Anti-NSE [NSE-P2]. Lane 1: SH-SY5Y, Lane 2: NT2/D1.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: NSEP2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Enolase 2/Neuron-specific Enolase Antibody (NSEP2) - BSA Free Summary

• Immunogen: Ovalbumin-conjugated synthetic peptides corresponding to human NSE amino acid sequence:NSE-P2: aa's 271-285 - TGDQLGALYQDFVRD
• Specificity: Not reactive with -isozyme of enolase.
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ENO2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100 - 1:2000
  • Immunohistochemistry 1:10 - 1:500
  • Western Blot 1:100 - 1:2000
• Application Notes: Positive control(s): Formalin-fixed, paraffin-embedded nerve tissue sections

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS
• Preservative: 0.02% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Enolase 2/Neuron-specific Enolase Antibody (NSEP2) - BSA Free

• 2-phospho-D-glycerate hydrolyase
• 2-phospho-D-glycerate hydro-lyase
• EC 4.2.1.11
• ENO2
• enolase 2 (gamma, neuronal)
• Enolase 2
• gamma-Enolase
• Neural enolase
• neuron specific gamma enolase
• neurone-specific enolase
• Neuronspecific Enolase
• Neuron-specific enolase
• NSE

Background

Neuron-specific enolase (NSE) is a glycolytic isoenzyme which is located in central and peripheral neurons and neuroendocrine cells. This enzyme is released into the CSF when neural tissue is injured. Neoplasms derived from neural or neuroendocrine tissue may release NSE into the blood. NSE is a useful substance that has been detected in patients with certain tumors, namely: neuroblastoma, small cell lung cancer, medullary thyroid cancer, carcinoid tumors, pancreatic endocrine tumors, and melanoma. Recombinant NSE was expressed in E.coli and purified by conventional chromatography techniques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Enolase 2/Neuron-specific Enolase Antibody (NBP2-50533). (Showing 1 - 1 of 1 FAQ).

1. Enolase came up as a candidate in mass spec. There are at least three isoforms which showed up once or twice or three times (as in three mass spec repeats). To validate the mass data, we are looking into quantitate each isoform. Which antibodies are specific for each of the three?
   • We checked all antibodies to Enolase 1, Enolase 2 and Enolase 3, but unfortunately no cross reactivity testing was performed for any of these antibodies. Considering how similar these proteins are, it is reasonable to expect some of them will react with other enolases. Base on immunogen sequence, we found some that were raised to the most diverse regions between these proteins, so it is possible that these will be the most  specific to the protein they were raised to.For Enolase 1, your best bet is NBP2-25147  as it was raised to N terminal peptide of bovine Eno1: MSILKVHAREIFFor Enolase 2, I found 3 candidate antibodies:NBP2-53158  and NBP2-50532  were raised to aa416-433 (ELGDEARFAGHNFRNPSVL) - it says these antibodies are only reactive with human but they will also work for mouse since the immunogen is 100% matchNBP2-50533, which was raised to aa271-285 (GDQLGALYQDFVRD) - which is also likely to react with mouse, the immunogen is 93% match with mouse (only last aminoacid is different)For Enolase 3, your best bet would be H00002027-M01 or H00002027-A01. both were raised to aa228-277 (KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG) - 98% match to mouseThe immunogens for all these antibodies fall into most variable regions, however, since we have not performed crossreactivity testing, we can not guarantee that they will not crossreact to some extent.

Bioinformatics

• Gene Symbol: ENO2