Enolase 2/Neuron-specific Enolase Antibody (NSEP1)

Images

 
There are currently no images for Enolase 2/Neuron-specific Enolase Antibody (NBP2-50532).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
Clone
NSEP1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Concentration
1 mg/ml

Enolase 2/Neuron-specific Enolase Antibody (NSEP1) Summary

Immunogen
Ovalbumin-conjugated synthetic peptides corresponding to human NSE amino acid sequence:NSE-P1: aa's 416-433 - LGDEARFAGHNFRNPSVL
Specificity
Not reactive with -isozyme of enolase.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ENO2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:2000
  • ELISA 1:100 - 1:2000
  • Immunohistochemistry 1:10 - 1:500

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS
Preservative
0.02% Sodium Azide
Concentration
1 mg/ml
Purity
Protein G purified

Notes

Positive control(s): IHC: formalin-fixed, paraffin-embedded nerve tissue sectionswestern blot: ?-isozyme of human enolase; 50-100 ng per lane.

Alternate Names for Enolase 2/Neuron-specific Enolase Antibody (NSEP1)

  • 2-phospho-D-glycerate hydrolyase
  • 2-phospho-D-glycerate hydro-lyase
  • EC 4.2.1.11
  • ENO2
  • enolase 2 (gamma, neuronal)
  • Enolase 2
  • gamma-Enolase
  • Neural enolase
  • neuron specific gamma enolase
  • neurone-specific enolase
  • Neuronspecific Enolase
  • Neuron-specific enolase
  • NSE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25147
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, IA, ICC/IF, IHC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-653
Species: Hu, Mu, Rt, Ch, Fe, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33012
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF4478
Species: Hu
Applications: WB, IHC
H00005670-Q01
Species: Hu
AF3844
Species: Hu, Mu
Applications: IHC
7954-GM/CF
Species: Hu
NBP2-42388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI

Publications for Enolase 2/Neuron-specific Enolase Antibody (NBP2-50532) (0)

There are no publications for Enolase 2/Neuron-specific Enolase Antibody (NBP2-50532).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Enolase 2/Neuron-specific Enolase Antibody (NBP2-50532) (0)

There are no reviews for Enolase 2/Neuron-specific Enolase Antibody (NBP2-50532). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Enolase 2/Neuron-specific Enolase Antibody (NBP2-50532). (Showing 1 - 1 of 1 FAQ).

  1. Enolase came up as a candidate in mass spec. There are at least three isoforms which showed up once or twice or three times (as in three mass spec repeats). To validate the mass data, we are looking into quantitate each isoform. Which antibodies are specific for each of the three?
    • We checked all antibodies to Enolase 1, Enolase 2 and Enolase 3, but unfortunately no cross reactivity testing was performed for any of these antibodies. Considering how similar these proteins are, it is reasonable to expect some of them will react with other enolases. Base on immunogen sequence, we found some that were raised to the most diverse regions between these proteins, so it is possible that these will be the most  specific to the protein they were raised to.For Enolase 1, your best bet is NBP2-25147  as it was raised to N terminal peptide of bovine Eno1: MSILKVHAREIFFor Enolase 2, I found 3 candidate antibodies:NBP2-53158  and NBP2-50532  were raised to aa416-433 (ELGDEARFAGHNFRNPSVL) - it says these antibodies are only reactive with human but they will also work for mouse since the immunogen is 100% matchNBP2-50533, which was raised to aa271-285 (GDQLGALYQDFVRD) - which is also likely to react with mouse, the immunogen is 93% match with mouse (only last aminoacid is different)For Enolase 3, your best bet would be H00002027-M01 or H00002027-A01. both were raised to aa228-277 (KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG) - 98% match to mouseThe immunogens for all these antibodies fall into most variable regions, however, since we have not performed crossreactivity testing, we can not guarantee that they will not crossreact to some extent.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Alexa Fluor 350 NBP2-50532AF350
Alexa Fluor 405 NBP2-50532AF405
Alexa Fluor 488 NBP2-50532AF488
Alexa Fluor 532 NBP2-50532AF532
Alexa Fluor 594 NBP2-50532AF594
Alexa Fluor 647 NBP2-50532AF647
Alexa Fluor 700 NBP2-50532AF700
Alexa Fluor 750 NBP2-50532AF750
Biotin NBP2-50532B
DyLight 350 NBP2-50532UV
DyLight 405 NBP2-50532V
DyLight 488 NBP2-50532G
DyLight 550 NBP2-50532R
DyLight 594 NBP2-50532DL594
DyLight 650 NBP2-50532C
DyLight 680 NBP2-50532FR
DyLight 755 NBP2-50532IR
FITC NBP2-50532F
HRP NBP2-50532H
Janelia Fluor 549 NBP2-50532JF549
Janelia Fluor 646 NBP2-50532JF646

Additional Enolase 2/Neuron-specific Enolase Products

Bioinformatics Tool for Enolase 2/Neuron-specific Enolase Antibody (NBP2-50532)

Discover related pathways, diseases and genes to Enolase 2/Neuron-specific Enolase Antibody (NBP2-50532). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Enolase 2/Neuron-specific Enolase Antibody (NBP2-50532)

Discover more about diseases related to Enolase 2/Neuron-specific Enolase Antibody (NBP2-50532).
 

Pathways for Enolase 2/Neuron-specific Enolase Antibody (NBP2-50532)

View related products by pathway.

PTMs for Enolase 2/Neuron-specific Enolase Antibody (NBP2-50532)

Learn more about PTMs related to Enolase 2/Neuron-specific Enolase Antibody (NBP2-50532).
 

Research Areas for Enolase 2/Neuron-specific Enolase Antibody (NBP2-50532)

Find related products by research area.

Blogs on Enolase 2/Neuron-specific Enolase

There are no specific blogs for Enolase 2/Neuron-specific Enolase, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Enolase 2/Neuron-specific Enolase Antibody (NSEP1) and receive a gift card or discount.

Bioinformatics

Gene Symbol ENO2
Novus 100% Guarantee