ENO3 Antibody - BSA Free

Immunohistochemistry-Paraffin: ENO3 Antibody [NBP1-85821] - Staining in human skeletal muscle and tonsil tissues using anti-ENO3 antibody. Corresponding ENO3 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: ENO3 Antibody [NBP1-85821] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.

Immunohistochemistry-Paraffin: ENO3 Antibody [NBP1-85821] - Staining of human skeletal muscle shows high expression.

Immunohistochemistry-Paraffin: ENO3 Antibody [NBP1-85821] - Staining of human tonsil shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ENO3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ENO3 Antibody - BSA Free (NBP1-85821) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-ENO3 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELYKSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDLTVTN
• Predicted Species: Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ENO3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ENO3 Protein (NBP1-85821PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ENO3 Antibody - BSA Free

• 2-phospho-D-glycerate hydrolyase
• 2-phospho-D-glycerate hydro-lyase
• beta-enolase
• EC 4.2.1
• EC 4.2.1.11
• enolase 3 (beta, muscle)
• Enolase 3
• enolase 3, (beta, muscle)
• GSD13
• MSE
• Muscle-specific enolase
• Skeletal muscle enolase

Background

ENO3 encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5' UTR.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ENO3 Antibody (NBP1-85821)(3)

Publications using NBP1-85821

• Lindskog C, Linne J, Fagerberg L et al. The human cardiac and skeletal muscle proteomes defined by transcriptomics and antibody-based profiling. BMC Genomics. 2015-06-25 [PMID: 26109061] (IF/IHC, Human)
• Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360]
• Ek S, Andreasson U, Hober S et al. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Mol Cell Proteomics 2006-06-01 [PMID: 16524965]

Bioinformatics

• Gene Symbol: ENO3