Home » Enah/Vasp-like » Enah/Vasp-like Antibodies » Enah/Vasp-like Antibody (5G1)

Enah/Vasp-like Antibody (5G1)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Enah/Vasp-like Antibody (5G1) [H00051466-M01] - Analysis of EVL expression in transfected 293T cell line by EVL monoclonal antibody (M01), clone 5G1.Lane 1: EVL transfected lysate(45 KDa).Lane 2: Non-transfected lysate.
Western Blot: Enah/Vasp-like Antibody (5G1) [H00051466-M01] - Analysis of EVL expression in transfected 293T cell line by EVL monoclonal antibody (M01), clone 5G1.Lane 1: EVL transfected lysate(45 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: Enah/Vasp-like Antibody (5G1) [H00051466-M01] - Analysis of monoclonal antibody to EVL on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Enah/Vasp-like Antibody (5G1) [H00051466-M01] - Detection limit for recombinant GST tagged EVL is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
5G1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Enah/Vasp-like Antibody (5G1) Summary

Immunogen
EVL (NP_057421, 309 a.a. ~ 419 a.a) partial recombinant protein with GST tag.PGTRAASQPPNSSEAGRKPWERSNSVEKPVSSILSRTPSVAK SPEAKSPLQSQPHSRMKPAGSVNDMALDAFDLDRMKQEILEE VVRELHKVKEEIIDAIRQELSGISTT
Localization
Cytoplasm, cytoskeleton. Cell projection, lamellipodium. Note=Targeted to the leading edge of lamellipodia and the distal tip of stress fibers through interaction with a number of proteins. In activated T-cells, localizes to the F-actin collar and the dis
Specificity
EVL - Enah/Vasp-like
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EVL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA immunofluorescence.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Enah/Vasp-like Antibody (5G1)

  • ena/VASP-like protein
  • Enah/Vasp-like
  • RNB6Ena/vasodilator-stimulated phosphoprotein-like

Background

Enah/Vasp-like (EVL) is a member of the Ena/VASP protein family. Ena/VASP proteins are actin-associated proteins involved in a range of processes that require dynamic actin remodeling such as axon guidance and lamellipodial and filopodial dynamics in migrating cells. EVL enhances actin nucleation and polymerization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Mena Antibody
NBP1-87914
Western Blot: Mena Antibody [NBP1-87914] - Analysis in human cell lines U2OS and MCF-7 using Anti-ENAH antibody. Corresponding ENAH RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Mena Antibody [NBP1-87914] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol and focal adhesion sites. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Mena Antibody [NBP1-87914] - Staining in human prostate and liver tissues using anti-ENAH antibody. Corresponding ENAH RNA-seq data are presented for the same tissues.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
VASP Antibody
NBP1-85792
Western Blot: VASP Antibody [NBP1-85792] - Analysis in human cell line HEL.
Immunocytochemistry/Immunofluorescence: VASP Antibody [NBP1-85792] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & focal adhesion sites. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: VASP Antibody [NBP1-85792] - Staining in human small intestine and skeletal muscle tissues using anti-VASP antibody. Corresponding VASP RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
EGFR Antibody
[Unconjugated]
AF231
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
A431 human epithelial carcinoma cell line was stained with Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). View our protocol for Staining Membrane-associated Proteins.
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(7 Publications)
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
TOR/mTOR Antibody
NB100-240
Western Blot: TOR/mTOR Antibody [NB100-240] - Detection of Human mTOR by Western Blot. Samples: Whole cell lysate (50, 15, 5 ug) from HeLa, and (50 ug) 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-mTOR antibody NB100-240 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Western Blot: TOR/mTOR Antibody [NB100-240] - Whole cell lysate from HeLa (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) and 293T (T; 50 ug) cells. Affinity purified rabbit anti-mTOR antibody used for WB at 0.4 ug/ml (A) used for IP at 3 ug/mg lysate. mTOR was also immunoprecipitated by a previous lot of this antibody and by rabbit anti-mTOR antibodies NB100-241 and NB100-58821. For blotting immunoprecipitated mTOR, NB100-58821 was used at 1 ug/ml. Detection: Chemiluminescence with exposure times of 30 seconds (A) and 3 minutes (B).
Proximity Ligation Assay: TOR/mTOR Antibody [NB100-240] - Secondary-conjugate Duolink II PLA in Hela cells. goat anti-human RPL26 (NBP2-22233) and rabbit anti-human mTOR (NB100-240). Image merged from DAPI (2ms) and Texas Red (100ms) exposures, 40X magnification.
(5 Publications)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
Sarcalumenin
Antibody
NBP2-13378
Immunocytochemistry/Immunofluorescence: Sarcalumenin Antibody [NBP2-13378] - Staining of human cell line U-251 MG shows positivity in vesicles.
Immunohistochemistry-Paraffin: Sarcalumenin Antibody [NBP2-13378] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: Sarcalumenin Antibody [NBP2-13378] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CAIN Antibody
NBP1-91745
Immunocytochemistry/Immunofluorescence: CAIN Antibody [NBP1-91745] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: CAIN Antibody [NBP1-91745] - Staining of human rectum shows strong nuclear and cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver cancer tissue using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver array using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
Semaphorin 6A
Antibody
NBP1-31551
Western Blot: Semaphorin 6A Antibody [NBP1-31551] - Sample(30 ug whole cell lysate) A:A431 B:Hep G2 7.5% SDS PAGE, antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Semaphorin 6A Antibody [NBP1-31551] - [N2C1], Internal detects SEMA6A protein at cytoplasm by immunofluorescent analysis. Sample: A431 cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: SEMA6A protein stained by SEMA6A antibody [N2C1], Diluted at 1:500.Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Semaphorin 6A Antibody [NBP1-31551] - Paraffin-embedded NCI-N87 xenograft, using antibody at 1:100 dilution.
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Zyxin Antibody
(CL2502)
NBP2-36768
Immunocytochemistry/Immunofluorescence: Zyxin Antibody (CL2502) [NBP2-36768] - Staining in U251 cell line showing distinct focal adhesion staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.
Immunohistochemistry: Zyxin Antibody (CL2502) [NBP2-36768] - Staining of human cerebral cortex shows absence of immunoreactivity in neuronal cells.
Immunocytochemistry/Immunofluorescence: Zyxin Antibody (CL2502) [NBP2-36768] - Staining in HeLa cell line showing distinct focal adhesion staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Somatostatin
Antibody (906552) [Un ...
MAB2358
Somatostatin was detected in immersion fixed human embryonic stem cells differentiated to pancreatic cells using Rat Anti-Human Somatostatin Monoclonal Antibody (Catalog # MAB2358) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). Specific staining was localized to cell membranes and cytoplasm. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
Somatostatin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Rat Anti-Human Somatostatin Monoclonal Antibody (Catalog # MAB2358) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). Specific staining was localized to cell membranes and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Somatostatin was detected in immersion fixed paraffin-embedded sections of human pancreas using Rat Anti-Human/Mouse Somatostatin Monoclonal Antibody (Catalog # MAB2358) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS017) and counterstained with hematoxylin (blue). Specific staining was localized to islet cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
Species: Hu, Mu
Applications: IHC, ICC
c-Abl Antibody
[Unconjugated]
AF5414
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, MCF‑7 human breast cancer cell line, and MDA‑MB‑453 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human c-Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for c-Abl at approximately 135 - 145 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for c‑Abl at approximately 149 kDa (as indicated) using 10 µg/mL of Goat Anti-Human c‑Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Publication)
Species: Hu
Applications: WB, Simple Western
Profilin 1 Antibody
NBP1-19344
Western Blot: Profilin 1 Antibody [NBP1-19344] - Western Blot on HeLa whole cell extracts.
Immunohistochemistry: Profilin 1 Antibody [NBP1-19344] - Staining of Profilin in mouse thymus.
Simple Western: Profilin 1 Antibody [NBP1-19344] - Simple Western lane view shows a specific band for Profilin 1 in 0.5 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(1 Publication)
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
ACTR2 Antibody
(1B10-C4)
H00010097-M01
Western Blot: ACTR2 Antibody (1B10-C4) [H00010097-M01] - ACTR2 monoclonal antibody (M01), clone 1B10-C4 Analysis of ACTR2 expression in Hela S3 NE.
Immunohistochemistry-Paraffin: ACTR2 Antibody (1B10-C4) [H00010097-M01] - Analysis of monoclonal antibody to ACTR2 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Western Blot: ACTR2 Antibody (1B10-C4) [H00010097-M01] - Western Blot analysis of ACTR2 expression in A-431 ( Cat # L015V1 ).
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
TTF2 Antibody
(1E8.)
H00008458-M06
Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/Immunofluorescence: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of monoclonal antibody to TTF2 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in PC-12 (Cat # L012V1).
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
E-Cadherin
Antibody [Unconjugate
AF748
Western blot shows lysates of A431 human epithelial carcinoma cell line, A549 human lung carcinoma cell line, HepG2 human hepatocellular carcinoma cell line, P19 mouse embryonal carcinoma cell line, and 4T1 mouse breast cancer cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for E‑Cadherin at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of 4T1 mouse breast cancer cell line, P19 mouse embryonal carcinoma cell line, A431 human epithelial carcinoma cell line, and MCF‑7 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for E‑Cadherin at approximately 128 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
E‑Cadherin was detected in immersion fixed D3 mouse embryonic stem cell line using Goat Anti-Human/MouseE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
(5 Reviews)
(23 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
OIP106 Antibody
NBP1-56761
Western Blot: OIP106 Antibody [NBP1-56761] - HT1080, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that TRAK1 is expressed in HT1080.
Western Blot: OIP106 Antibody [NBP1-56761] - HT1080 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: OIP106 Antibody [NBP1-56761] - HCT15, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that TRAK1 is expressed in HCT15.
Species: Hu
Applications: WB
Contactin-1
Antibody [Unconjugate
AF904
Western blot shows lysates of human brain (cortex) tissue, human brain (cerebellum) tissue, mouse brain (cerebellum) tissue, mouse brain (total) tissue, and rat brain (total) tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Contactin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF904) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Contactin‑1 at approximately 135 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of human brain tissue and mouse brain tissue, loaded at 0.2 mg/mL. A specific band was detected for Contactin‑1 at approximately 158 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Contactin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF904) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Contactin‑1 was detected in immersion fixed paraffin-embedded sections of human dorsal root ganglia using 15 µg/mL Goat Anti-Human/Mouse/Rat Contactin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF904) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(8 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
(38 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Perforin Antibody
(deltaG9)
NBP1-45774
Immunocytochemistry/Immunofluorescence: Perforin Antibody (deltaG9) [NBP1-45774] - Isolated CD8 T-cells showing intracellular perforin (green).
(1 Review)
Species: Hu
Applications: Flow, ICC/IF, IHC, IP

Publications for Enah/Vasp-like Antibody (H00051466-M01) (0)

There are no publications for Enah/Vasp-like Antibody (H00051466-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Enah/Vasp-like Antibody (H00051466-M01) (0)

There are no reviews for Enah/Vasp-like Antibody (H00051466-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Enah/Vasp-like Antibody (H00051466-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Enah/Vasp-like Products

Bioinformatics Tool for Enah/Vasp-like Antibody (H00051466-M01)

Discover related pathways, diseases and genes to Enah/Vasp-like Antibody (H00051466-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Enah/Vasp-like Antibody (H00051466-M01)

Discover more about diseases related to Enah/Vasp-like Antibody (H00051466-M01).
 

Pathways for Enah/Vasp-like Antibody (H00051466-M01)

View related products by pathway.

PTMs for Enah/Vasp-like Antibody (H00051466-M01)

Learn more about PTMs related to Enah/Vasp-like Antibody (H00051466-M01).
 

Research Areas for Enah/Vasp-like Antibody (H00051466-M01)

Find related products by research area.

Blogs on Enah/Vasp-like

There are no specific blogs for Enah/Vasp-like, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Enah/Vasp-like Antibody (5G1) and receive a gift card or discount.


Bioinformatics

Gene Symbol EVL
Entrez
Uniprot