EMSY Antibody (5D1) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: EMSY Antibody (5D1) [H00056946-M01] - Analysis of monoclonal antibody to C11orf30 on HeLa cell . Antibody concentration 10 ug/ml.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 5D1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

EMSY Antibody (5D1) - Azide and BSA Free Summary

• Immunogen: C11orf30 (NP_064578, 1081 a.a. ~ 1178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PASSEKQTASQVEQPIITQGSSVTKITFEGRQPPTVTKITGGSSVPKLTSPVTSISPIQASEKTAVSDILKMSLMEAQIDTNVEHMIVDPPKKALATS
• Specificity: C11orf30 - chromosome 11 open reading frame 30
• Isotype: IgG3 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: EMSY
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EMSY Antibody (5D1) - Azide and BSA Free

• chromosome 11 open reading frame 30
• EMSYFLJ90741
• protein EMSY

Background

EMSY is a novel protein whose sequence is found in a chromosomal region known to be involved in breast and ovarian cancer (1). The N-terminus of EMSY binds BRCA2 (exon 3). EMSY is capable of silencing the exon 3 encoded transcrip-tional activation domain of BRCA2. EMSY, just like BRCA2, is located in the nucleus and functions with DNA repair and transcriptional regulation factors (2). EMSY was found to be overactive in 13% of sporadic cases of breast cancer and 17% of ovarian cancers and it was also linked with poor survival, specifically in node-negative breast cancer, suggesting that it may be of prognostic value (1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EMSY
• Entrez:
  • 56946(Human)
• OMIM:
  • 608573(Human)
• Uniprot:
  • NP_064578(Human)